KEGG   Mycobacterium intracellulare MOTT-02: OCO_33060Help
Entry
OCO_33060         CDS       T01754                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00250  Alanine, aspartate and glutamate metabolism
mit00280  Valine, leucine and isoleucine degradation
mit00310  Lysine degradation
mit00410  beta-Alanine metabolism
mit00640  Propanoate metabolism
mit00650  Butanoate metabolism
mit01100  Metabolic pathways
mit01120  Microbial metabolism in diverse environments
Module
mit_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    OCO_33060
   00650 Butanoate metabolism
    OCO_33060
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCO_33060
   00280 Valine, leucine and isoleucine degradation
    OCO_33060
   00310 Lysine degradation
    OCO_33060
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCO_33060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mit01007]
    OCO_33060
Enzymes [BR:mit01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     OCO_33060
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     OCO_33060
    2.6.1.48  5-aminovalerate transaminase
     OCO_33060
Amino acid related enzymes [BR:mit01007]
 Aminotransferase (transaminase)
  Class III
   OCO_33060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFC49669
LinkDB All DBs
Position
3558223..3559566
Genome map
AA seq 447 aa AA seqDB search
MVAGLEQTRQLVTEIPGPLSLELSKRRAAAVSHAVNVSVPVFVARAGGGIIEDVDGNRLI
DLGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGSGEKR
SVLFNSGAEAVENAVKVARAYTRKSAVVAFNHAYHGRTNLTMALTAKSMPYKAGFGPFAP
EVYRAPLSYPYRDGLIDKELATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIV
PAEGFLPTLLEWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPL
SAVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERAQQLERLITEPLL
RLQAGDDRIGDVRGRGAMIAIELVKSGTAEPDRELTQRLTVAAQAAGVIVLTCGMFGNII
RLLPPLTIGDELLAEGIDILSGLLRDL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggtggccggcctcgagcagactcgccaactggtcaccgagatccccggcccgctctcg
ctggaactgagcaagcgccgggcggcggcggtgtcgcacgcggtcaacgtctccgtcccg
gtcttcgtggcgcgcgccggcggcggcatcatcgaggacgtcgacggcaaccggctcatc
gacctcggctccggcatcgcggtgacgaccatcggcaactcggcgccccgggtggtcgac
gcggtgcgcgcgcaggtcgccgagttcacccacacctgcttcatggtgacgccgtacgag
tcgtacgtcgcggtggccgagacgctcaaccggatcaccccgggctccggcgagaagcgc
tcggtgctgttcaattccggcgccgaggccgtcgagaacgccgtcaaggtcgcgcgcgcc
tacacgcgcaagtcggcggtggtcgcgttcaaccacgcctaccacggccgcaccaacctg
acgatggcgctgaccgcgaagtccatgccctacaaggccggcttcggcccgttcgcgccg
gaggtctaccgggcaccgctgtcctacccctatcgggacggcctgatcgacaaggagctg
gccaccgacggggagaaggccgccgcgcgggccatccgggtcatcgacagccagatcggc
gccgacaacctggccgccctcctgatcgagccgatccagggcgaaggcgggttcatcgtg
ccggccgagggattcctgcccaccctgctggagtggtgccgcaggaacgacgtggtgttc
atcgccgacgaggtgcagaccggtttcgcgcgctcgggcgccatgttcgcctgcgaacac
gagggcatcgagcccgacctgatctgcaccgccaaggcgatcgccgacgggcttcccctg
tcggcggtcaccggccgggccaacatcatggacgcgccgcacgtcggcggcctcggcggc
accttcggcggcaaccccctggcctgcgcggcggcgttggccacgatcgagacgatcgag
agcgacgggctggtcgagcgggcccagcagctggagcggctcatcaccgaaccgctgctg
cggctgcaggccggcgacgaccggatcggcgacgtccgcggccgcggcgcgatgatcgcg
atcgagttggtgaagtcggggaccgccgagcccgacagggaactgacccaaaggctgacc
gtcgccgcccaggccgccggcgtcatcgtcctgacctgcggcatgttcggcaacatcatc
cggctgctgccgccgctgaccatcggcgacgagctgctggccgagggaatcgacatcctg
agcgggttgttgcgcgacctgtaa

DBGET integrated database retrieval system