KEGG   Mycobacterium intracellulare MOTT-02: OCO_37940Help
Entry
OCO_37940         CDS       T01754                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mit  Mycobacterium intracellulare MOTT-02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFC50157
LinkDB All DBs
Position
4023945..4025372
Genome map
AA seq 475 aa AA seqDB search
MQIAGSDGARPQASVLHVISPHTEEPIAEVNAAGSDDVDAAVAAARAAFGPWGRSEPAER
VAAIRRLADIYDGRRAEMATTITAEIGAPISFAQRAQVGLPAFMMRAFCDLAERHPWQET
RPGFFGSDVHVRKEPVGVVAAIVPWNMPQFLIVTKLVPALLAGCAVVLKPAPESPLDALL
LGEMIAEAGLPPGVVSILPGDGALGAYLVAHPGVDKVSFTGSTAAGRAVAASCAVNLTKV
SLELGGKSAALVLDDASPDKVAAGVRSASLSNSGQICNALTRVLVPQGRHDEYVDALAAE
MAGLRVGDPNDPDTQLGPLVSRRQQQRVRDYIEIGQNEGARVVIGGTDMPDGLDRGWYVR
PTLFAAADNSMRIAREEIFGPVITVIPYRDDEEALAIANDSDYGLAGSVWSDDSDRALAM
ATRIHTGTVGVNQGYTMDPFAPFGGVKASGYGRELGPEGLDGYLETKSIAIAAES
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatcgccggaagcgatggggcgcggccgcaggccagcgtcttgcacgtcatctct
ccgcacaccgaggaaccgatcgccgaggtcaatgcggcgggatccgacgacgtcgacgcg
gcggtggcggcggcgcgcgcggccttcgggccctggggccgcagcgagccggcggaacgg
gtcgccgcgatccggcggctggccgatatctacgacggacgccgcgccgagatggccacc
acgatcacggccgagatcggcgccccgatcagcttcgcccagcgggcccaggtcggcctg
ccggcattcatgatgcgcgcgttctgcgacctggccgaacggcacccgtggcaggagacc
aggcccgggttcttcggaagcgacgtgcacgtccgcaaggaacccgtcggcgtcgtcgcg
gcgatcgtgccctggaacatgccccagttcctcatcgtcaccaaactggtgcccgcgctg
ttggccggctgcgccgtcgtgctcaaacccgcccccgaaagcccgttggacgcgctgctt
ttaggcgagatgatcgccgaagccggcctgccgccgggcgtggtcagcatcctgccgggc
gacggtgcgctgggcgcctacctcgtcgcccacccgggcgtcgacaaagtgtcgttcacc
ggctccaccgcggcggggcgggcggtggccgcatcgtgtgcggtcaacctcaccaaagtc
agcctggaactcggcggcaagtccgccgccctggttctcgacgacgcatcgccggacaag
gtggccgccggggtgcgatccgcgagcctgtccaacagcggccagatctgcaatgcgctc
acccgggtcctggtgccgcaggggcgccacgacgagtacgtcgacgcgctcgccgccgag
atggccggccttcgcgtcggcgatcccaacgatcccgacacccagctcggtccgttggtg
tcccggcgccagcagcaacgcgttcgcgactacatcgagatcggccagaacgagggggcg
cgcgtcgtcatcggcggcaccgacatgcccgacggactcgaccgcggctggtatgtccgg
cccaccctgttcgcggcggccgacaattcgatgcgcatcgcccgggaggagatctttggg
cccgtcatcaccgtcatcccctaccgcgatgacgaggaggcgctggcgatcgccaacgat
tccgattacggcctggccggctcggtgtggagcgacgacagcgaccgtgcgctggcgatg
gccacccgcatccacaccgggaccgtcggcgtcaaccagggctacacgatggatccgttc
gcgcccttcgggggcgtcaaggccagcggctacggccgcgaactcgggcccgaaggcctc
gacggttacctggaaacgaagtcgatcgccatcgccgcggaatcctag

DBGET integrated database retrieval system