KEGG   Mycobacterium intracellulare MOTT-02: OCO_39140Help
Entry
OCO_39140         CDS       T01754                                 

Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00380  Tryptophan metabolism
mit00630  Glyoxylate and dicarboxylate metabolism
mit01110  Biosynthesis of secondary metabolites
mit01130  Biosynthesis of antibiotics
mit01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCO_39140
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    OCO_39140
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     OCO_39140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI TetR_C_31
Motif
Other DBs
NCBI-ProteinID: AFC50277
LinkDB All DBs
Position
4140863..4142965
Genome map
AA seq 700 aa AA seqDB search
MATDQNPKQRDLDSARFRRDTGYLTTQQGVRVDHTDDSLSVGDRGPTLLEDFHAREKITH
FDHERIPERVVHARGAGAYGYFEPYDDALAQYTAARFLTTPGLQTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIPQAQSA
HDTLWDFVALQPETLHTIMWLMSDRALPRSYRMMQGFGVHTFRLVNDRGEGTFVKFHWKP
RLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESGQYPEWELGVQLVPEEDEFSFDFDLLD
ATKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPVAEVRTNQHDGYGQHAIPQGRSSYYKNTIGGGCPALADE
NVFRHYTQRLDGQTMRKRAESFENHYSQARMFWMSMTRVEAEHIVAAFAFELGKVEMPEI
RSAVVAQLARVDGELAAQVAAKLGLPAPPEEQVDTVTASPALSQVTDAGDTIESRKVAVL
AANGVDVVGTQRFIELMGQRGAVVEVLAPVAGGTLEGGSGGELPVDRSFTTMASVLYDAV
VVACGPRSIATLSNDGYAVHFVTEAYKHLKPIGAYGAGVDLLRTAGITNRLAEDTDVLND
QSVITTKAAADELPDRFVEEFAGALAQHRCWQRRTDPVPA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaccagaatcccaagcagcgcgacctggactccgcacgcttccgtcgggac
accggatacctgacgacccagcagggcgtgcgcgtcgaccacaccgacgattcgctgtcg
gtcggtgaccggggaccgacgctgctggaggactttcacgcccgggagaagatcactcac
ttcgaccacgagcgcatcccggagcgcgtggtgcacgcgcggggcgccggcgcctacggc
tatttcgaaccgtacgacgacgcgttggcgcaatacaccgcggcgagattcttgaccact
ccaggcttgcagaccccggtgttcgtgcgattctccacggtggccggctcgcggggttcg
gccgacaccgtgcgcgacgtgcgcggcttcgccaccaagttctacaccgaacaaggcaat
tacgacctggtgggcaacaacttcccggtgttcttcatccaggacggcatcaagttcccc
gatttcgtgcacgcggtgaaaccggagccgcacaacgagattccgcaggcgcagtcggcc
cacgacacgctctgggacttcgtggcgctgcagcccgagacgctgcacaccatcatgtgg
ctgatgtcggaccgggcattgccgcgtagctaccggatgatgcagggcttcggcgtgcac
accttccggttggtaaacgaccgcggcgagggcactttcgtgaagttccactggaagccg
cggctcggcgtgcactctctgatctgggacgaatgccaaaagatcgccggcaaagacccc
gattacaaccgccgcgacctgtgggaggccatcgagtcgggccagtatccggagtgggag
ctcggcgtccagctcgtgcccgaggaggacgagttcagcttcgatttcgatcttctcgac
gcgacgaaaatcattcccgaggaacaggttccggtgcgcccggtgggcaagatggtgctc
aaccgcaacccggacaacttcttcgccgagaccgagcaggtcgcgttccacacggcgaac
gtggtgcccggcatcgacttcaccaacgatccgctgctgcagttccgcaacttctcctac
ctggacacccaactgatccggctgggcggccccaacttcgcccagctgccgatcaatcgg
ccggtggccgaggtccggaccaaccagcacgacggctacggacagcacgcgattccgcag
ggccgctccagctactacaagaacaccatcggcggcggctgcccagcgctggccgacgag
aacgtgttccggcactacacccagcggctcgacgggcagaccatgcgtaagcgggccgag
tccttcgagaatcactacagccaggcgcggatgttctggatgagcatgacgcgcgtggag
gccgaacacatcgtcgccgcgttcgctttcgagctcggcaaggtggagatgcccgagatc
cgttcggcggtggtggcacagctcgcgcgggtcgacggcgagttggccgcccaggtggcc
gcgaagctggggcttcccgcgccgcccgaggagcaggtcgacacggtgaccgcctcaccg
gcgctgtcacaggtcaccgacgccggcgacaccatcgaatcgcgcaaggtcgccgtgctg
gccgccaacggcgtcgatgtggtggggacacagcgctttatcgagctgatgggacagcgc
ggggccgtggtcgaggtgttggcgccggtggccggcggcacgctggagggcgggtccggc
ggcgaactgcccgttgaccggtccttcacgacgatggcgtcggtgctctacgacgcggtc
gtggtggcgtgcgggccgcggtcgatcgcgacgctgtccaacgacgggtatgcggtgcac
ttcgtgaccgaggcctacaagcatctcaagcccatcggggcgtacggcgccggcgtcgac
ctgctgcgcaccgccggtatcaccaaccgcctcgccgaggacaccgacgtgctcaacgac
cagtccgtcatcaccaccaaggccgccgccgacgagttgcccgatcgcttcgtcgaggaa
ttcgccggcgcgctcgcccaacaccgttgctggcaacggcgcaccgacccggttccggcc
tag

DBGET integrated database retrieval system