KEGG   Mycobacterium intracellulare MOTT-02: OCO_48170Help
Entry
OCO_48170         CDS       T01754                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00020  Citrate cycle (TCA cycle)
mit00190  Oxidative phosphorylation
mit00650  Butanoate metabolism
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
mit01200  Carbon metabolism
Module
mit_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mit_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mit_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCO_48170
   00650 Butanoate metabolism
    OCO_48170
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OCO_48170
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OCO_48170
    1.3.5.4  fumarate reductase (quinol)
     OCO_48170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like GIDA Thi4 Pyr_redox_3 AlaDh_PNT_C FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AFC51179
LinkDB All DBs
Position
5050935..5052878
Genome map
AA seq 647 aa AA seqDB search
MVDVERHAYDVVVIGAGGAGLRAVIEARERGLRVAVVCKSLFGKAHTVMAEGGCAASMGN
TNPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRLKDGKISQRN
FGGHTYPRLAHVGDRTGLELIRTMQQKIVSLQQEDYAELGDYEARIRVFAETTITELIKD
GDAIAGAFGYIRESGNFILFEAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGASL
INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSDDKRFMFDYIPPVFKGQYAETE
QEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGSPHGGVFLDIASRLTPAEINRR
LPSMYHQFKELAGVDITKEPMEVGPTCHYVMGGVEVDADTGAATVPGLFAAGECSGGMHG
SNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPTVGDGAVEAAAKRALSPFEAPAGGGP
GENPYTLQLELQQSMNDLVGIIRNADEISEALARLDKLRERFKNLHVEGQRRYNPGWNLA
IDLRNMLLVSECVAKAALQRTESRGGHTRDDHPSMDSSWRKLLLVCEAVAEPGDVEAAVI
PDITITKKEQTPMRPDLLELFDIAELEKYYTDEELAGHPGRTPRTEK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgtcgagcggcatgcctacgacgtagtcgtcatcggcgccggcggcgcggga
ttgcgcgcggtcatcgaggcgcgcgaacgcggcctgcgggtcgcggtggtgtgcaagtcc
ctgttcggcaaggcacacaccgtgatggccgagggtgggtgcgcggcctcgatgggcaac
accaacccgaaggacaactggaagacccacttcggcgacacgatgcgcggtgggaagttc
ctcaacaactggcggatggccgaactgcacgccaaggaggccccggaccgcgtctgggag
ctggaaacctatggcgcgctgttcgatcgcctcaaggacggcaagatcagccagcgcaac
ttcggcgggcacacctacccgcggctggcgcacgtcggtgaccgcaccggcctggagctg
atccgcaccatgcagcagaagatcgtctcgctgcagcaggaggactacgccgagctcggc
gactacgaggcccgcatccgggtgttcgccgaaaccacgatcaccgaactgatcaaggac
ggcgacgcgatcgccggggcgttcggctacatccgcgaaagcggcaacttcatcctgttc
gaggcgcccgcggtggtgctggccaccggcggcatcggcaagtcattcaaggtcacctcg
aactcctgggagtacaccggcgacgggcacgccctggcgctccgggcgggcgcgtccctg
atcaacatggagttcgtccagttccacccgacgggcatggtgtggccgccgagcgtgaag
gggatcctggtcaccgagggcgttcgcggcgacggcggggtgctgaagaactccgacgac
aagcggttcatgttcgactacatcccgccggtcttcaaaggccagtacgccgagaccgag
caagaggccgaccagtggctcaaggacaacgactcggcccgccgcacccctgacctgctg
ccgcgcgacgaggtcgcgcgcgcgatcaactccgaggtcaaggccggccggggcagccca
cacggcggcgtcttcctcgacatcgcgtcgcggctgacgccggcggagatcaaccgccgc
ctgccgtcgatgtaccaccagttcaaggagctggccggggtcgacatcaccaaggagccg
atggaagtcgggccgacctgccactacgtgatgggcggcgtcgaggtcgacgccgacacc
ggggcggccaccgtgcccgggctcttcgccgcgggcgaatgctccggcggcatgcacggc
tcgaaccggctgggcggcaactcgctgtcggacctgctggtattcggccggcgcgccggc
ctgggcgccgccgactacgtgcgggcgctgagcagccgtccgacggtcggcgacggcgcc
gtcgaggcggcggcgaagcgggccctgtcccccttcgaggcgccggcgggcggcggcccc
ggcgagaacccctacaccctgcagctcgagctgcagcagtcgatgaacgacctggtcggc
atcatccgcaatgccgacgagatctccgaggctttggcccggctcgacaagctgcgggag
cggttcaagaacctgcatgtggaggggcagcgccgctacaacccgggctggaacctggcc
atcgacctgcgcaacatgctgctggtcagcgaatgcgtcgccaaggccgcgctgcagcgc
accgagagccggggcgggcacacccgcgacgaccacccgtcgatggactcgtcgtggcgc
aagctgttgctggtctgcgaggcagtcgccgagccaggcgacgttgaagccgcggtgatc
cccgacatcaccatcacgaagaaagagcagacgccgatgcggcccgatctgctggaactg
ttcgacatcgccgagctggagaagtactacaccgacgaggagctcgccgggcatccaggg
cggacacccaggacggagaagtaa

DBGET integrated database retrieval system