KEGG   Mycobacterium intracellulare MOTT-02: OCO_48180Help
Entry
OCO_48180         CDS       T01754                                 

Definition
(GenBank) fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00020  Citrate cycle (TCA cycle)
mit00190  Oxidative phosphorylation
mit00650  Butanoate metabolism
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
mit01200  Carbon metabolism
Module
mit_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mit_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mit_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCO_48180
   00650 Butanoate metabolism
    OCO_48180
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OCO_48180
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OCO_48180
    1.3.5.4  fumarate reductase (quinol)
     OCO_48180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_18 Fer4_17 Fer4_9 Fer4_7 Fer4_16 Thioredoxin_7 Fer4_10
Motif
Other DBs
NCBI-ProteinID: AFC51180
LinkDB All DBs
Position
5052879..5053625
Genome map
AA seq 248 aa AA seqDB search
MTYNATMRVWRGDDANGALQDFTVEVNEGEVVLDIIHRLQQTQTPDLAVRWNCKAGKCGS
CSAEINGYPRLLCMTRMSTFAEDEVVTVTPLRTFPVIRDLVTDVSFNYEKAREIPSFAPP
KDLQPGEYRMAQEDVQRSQEFRKCIECFLCQNVCHVVRDHEENKKAFAGPRFLMRIAELE
MHPLDTRDRRKDAQEEHGLGYCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVW
LGNKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaacgcgacgatgcgggtgtggcgcggcgacgacgccaacggtgcgttgcag
gacttcaccgtcgaggtcaacgagggtgaggtcgtcctcgacatcattcaccgcctgcag
cagacccagacgcccgacctggcggtccggtggaactgcaaggcgggcaagtgcggctcg
tgctccgcggagatcaacggctatccgcggttgctctgcatgacccggatgtcgacgttc
gccgaggacgaggtcgtcacggtcacgccgctgcggacgttcccggtgatccgggacctg
gtcaccgacgtctcgttcaactacgagaaggcccgcgagataccgtctttcgcaccgccc
aaggacctgcaacccggcgagtaccggatggcgcaggaggacgtccagcgctcccaagag
ttccgcaagtgcatcgaatgcttcctgtgccagaacgtgtgccacgtggtccgcgaccac
gaggagaacaagaaggcgttcgccggcccccgcttcctgatgcggatcgccgagctggag
atgcacccgctggacacccgggaccggcgcaaggacgcccaggaagagcacggcctgggg
tactgcaacatcaccaagtgctgcaccgaggtctgcccggagaacatcaagatcaccgac
aacgcgctgatcccgatgaaggagcgcgtcgccgaccgcaagtacgacccggtggtctgg
ctcggtaacaagctgttccgtcgctga

DBGET integrated database retrieval system