KEGG   Mitsuaria sp. 7: ABE85_12255Help
Entry
ABE85_12255       CDS       T04402                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
miu  Mitsuaria sp. 7
Brite
Enzymes [BR:miu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ABE85_12255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu MOFRL
Motif
Other DBs
NCBI-ProteinID: ANH68151
UniProt: A0A1A9HK95
LinkDB All DBs
Position
2773633..2774160
Genome map
AA seq 175 aa AA seqDB search
MTLRPLLAAALVACLPVTAALAAEATVTLKVATPQGEGGPVGTVAMEDTKYGLVFTPKLT
GLPPGLHGFHVHANPSCAAADKDGKPSPAEAAGGHFDPKKSGKHGEPWGDGHLGDLPPMF
VNGEGEASQPVLAPRLKLADVKGHALMVHAGGDNHADHPAPLGGGGARIACGVIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcgccccttgctggccgccgccctggtggcctgcctgcccgtgaccgccgcg
ctcgccgccgaagccaccgtgaccttgaaggtcgccaccccgcagggggaaggcggaccg
gtcggcaccgtcgcgatggaggacacgaagtacggcctcgtcttcacgcccaagctcacc
ggcctgccgccggggctgcacggcttccacgtgcacgcgaatccgtcctgcgccgcggcg
gacaaggacggcaagccctcccccgccgaagcggccggcggccatttcgatccgaagaag
tccggcaagcacggcgagccctggggcgacggccacctgggcgacctgcccccgatgttc
gtcaacggggaaggcgaagccagccagcccgtgctcgcgccgcgcctgaagctggcggac
gtcaagggacatgcgctgatggtccacgcgggcggcgacaaccatgccgaccaccctgcc
ccgctcggcggcggcggagcgcgcatcgcgtgcggcgtgatccagtga

DBGET integrated database retrieval system