KEGG   Mitsuaria sp. 7: ABE85_13460Help
Entry
ABE85_13460       CDS       T04402                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
miu  Mitsuaria sp. 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase HDOD Pkinase_Tyr GAF_2 APH Kdo RIO1
Motif
Other DBs
NCBI-ProteinID: ANH70538
UniProt: A0A1A9HU15
LinkDB All DBs
Position
complement(3071587..3073995)
Genome map
AA seq 802 aa AA seqDB search
MPPAVGRFKPLRSLGQGAQAVVWLAHDPRLDREVALKVLTQAVDRASVDAWLHEARAVSR
LTHPNIVPVFEADIEAGQAYMVFEYVPGGTLTERLRQRGRLPAREAVAMMLGILDGLHAA
HQAGVVHRDLKPSNILIDSTGRPKVMDFGIAGRIQSGAASVVGAAARPNRIVGTPGYISP
EAARGDPASPVMDVFAASVMLSEMLSGQRLNYDPDPWRAVRRAMEQTLDPPADLGPDSDD
ALRAVLLRGLSRESSQRWADAKAFHDALAAWLHPAASEATEGGEGGNATLEFLLRRMRHR
SDFPAMADSVTRIQRMTQSENESLTSLSNEILKDVALTNKLLRLVNTVQFSHAGGGHIST
VSRAVALVGFGGIRNLALSLVLLERMENKSHAQRLKEEFLRSLMAGSLARELCLVPRENE
ESFLATMFQGLGRLLAEFYLPEEAQQVRRVVRPERGMGEQAAPPLSEAAASAQVLGLSYE
SLGLGVARQWGFPDSLQRSMQRPDGDAPTRLVEHSTDRMRWLGRASNDVADVILNSDPAE
AHAKVRAMAQRYARALGVEAKAFEAAADQARQRLTQLAQAMDIKLAKNSPAQRLLAPLTP
SAEDTLSPHQLQATVVEGQAPAGVIPSEQAAATLAAGIQDITNAMVESFKLNEILRMILE
TMYRGLGFRRVIFCLRDAKTETLTGRFGLGDGVEAVVPLFRVPLRVMPGLPADLFTAICT
KGVDTLIADASQPKIAERLPPWFLSGAKAHSFLILPMALRGAPFAMIYADKAEPGSVVLD
EKQLSLLRTLRNQAVMAFKQAS
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgccgtcgggcgattcaagccgctgcgcagtcttgggcagggtgcccaggcg
gtggtgtggctggcccacgatccgcggctggaccgcgaggtcgcgctgaaggtgctgacg
caggcggtggaccgcgcgagcgtggacgcctggctgcatgaggcgcgcgcggtcagccgg
ctgacgcatcccaacatcgtgccggtcttcgaggccgacatcgaggccggccaggcctac
atggtcttcgagtacgtgcccggcggcacgttgaccgagcggctgcgccagcgcggccgg
ctgccggcgcgcgaggccgtcgcgatgatgctgggcatcctcgacggcctgcacgcggcg
caccaggcgggtgtcgtgcatcgcgacctgaagccgtccaacatcctgatcgactcgacg
ggccggcccaaggtgatggacttcggcatcgcgggacgcatccagtccggcgcggccagc
gtggtcggcgcggcggcccgcccgaaccgcatcgtcggcacgccgggctacatctcgccg
gaagcggccaggggcgatccggcatcgccggtgatggacgtcttcgccgcctcggtgatg
ctgagcgagatgctgtccggccagcggctcaactacgaccccgatccgtggcgcgcggtg
cgccgcgcgatggagcagacgctggatccgccggccgacctcggccccgacagcgacgac
gcgctgcgcgccgtgctgctgcgcggcctctcgcgagagtcctcgcagcgctgggccgat
gccaaggctttccacgacgcgctcgccgcgtggctgcatccggccgccagcgaagccacg
gaaggcggcgagggcggcaacgcgacgctggagttcctgctgcgccgcatgcggcaccgc
agcgacttcccggcgatggccgattcggtgacgcgcatccagcggatgacgcagtccgag
aacgagagcctgacctcgctctccaacgagatcctcaaggacgtcgcgctcaccaacaag
ctgctgcggctggtcaacacggtgcagttcagccatgccggcggcgggcacatcagcacg
gtgtcgcgggcggtggcgctggtgggcttcggcggcatccgcaacctggcgctgtcgctg
gtgctgctggagcgcatggagaacaagagccacgcgcagcgcctgaaggaggagttcctc
cgctcgctgatggcgggctcgctggcgcgcgagctgtgcctggtgccgcgcgagaacgag
gagtccttcctcgccacgatgttccagggactgggccggctgctggccgagttctacctg
cccgaggaggcgcagcaggtgcgccgcgtcgtgcggcccgagcgcggcatgggcgagcag
gccgcgccgccgctgagcgaggccgcggcctccgcgcaggtgctggggctgagctacgag
agcctcggcctgggcgtggcgcggcagtggggcttcccggacagcctgcagcgcagcatg
cagcggcccgacggcgatgcgccgacgcggctggtggagcattcgaccgaccgcatgcgc
tggttgggccgcgcgagcaacgacgtcgcggacgtcatcctgaacagcgaccccgccgag
gcgcatgccaaggtacgcgcgatggcgcagcgctacgcgcgcgcgctgggcgtcgaggcc
aaggccttcgaggccgcggcggaccaggcgcggcagcggctgacgcagctcgcgcaggcg
atggacatcaagctggcgaagaactcgccggcgcagcgcctgctggcgccgctgacgccg
tcggcggaggacaccctctcgccgcaccagctgcaggcgacggtggtggaagggcaggcg
ccggccggcgtgatcccgtccgagcaggcggcggcgacgctggccgccggcatccaggac
atcaccaacgcgatggtcgagagcttcaagctcaacgagatcctgcggatgatcctggag
acgatgtaccgcgggctgggcttccgccgggtgatcttctgcctgcgcgacgcgaagacc
gagacgctcaccggccgcttcggcctgggcgacggggtggaggcggtggtgccgctgttc
cgcgtgccgctgcgggtgatgccgggcctgccggcggacctcttcacggcgatctgcacg
aagggcgtggacacgctgatcgccgacgcctcgcagcccaagatcgccgagcggctgccg
ccgtggttcctcagcggggccaaggcgcacagcttcctgatcctgccgatggcgctgcgc
ggcgcgccgttcgcgatgatctacgcggacaaggcggagccgggcagcgtcgtgctcgac
gagaagcagctctcgctgctgcgcacgctgcgcaaccaggccgtgatggcgttcaagcag
gcgagttga

DBGET integrated database retrieval system