KEGG   Mitsuaria sp. 7: ABE85_21845Help
Entry
ABE85_21845       CDS       T04402                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
miu  Mitsuaria sp. 7
Pathway
miu00473  D-Alanine metabolism
miu01100  Metabolic pathways
miu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:miu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABE85_21845
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ABE85_21845
Enzymes [BR:miu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABE85_21845
Peptidoglycan biosynthesis and degradation proteins [BR:miu01011]
 Precursor biosynthesis
  Racemase
   ABE85_21845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANH69560
UniProt: A0A1A9HRC4
LinkDB All DBs
Position
4964524..4965627
Genome map
AA seq 367 aa AA seqDB search
MPRPIEALIHQPALAHNIARARACAPDAQVFAVVKANAYGHGIERAFDALRSADGFAMLD
LDEAQRVRDLGWRGPILLLEGCFESRDLELCSRLKLWHAVHHEQQVDWLAMHKTHEPHRV
FLKLNSGMNRLGFTPSAFRGAWTRLNALPQVDEISLMTHFSDADGPRGIAHQTAVFAEAT
ADLPGARTLSNSAAILRHSQDPTVRADWVRSGIMTYGSAPDFPEHDITHWDLKPTMTLRA
KVLAVQQLKEGDSVGYGSSFVAQRAMRIGTVACGYADGYPRHAAHGTPVLVGGKRSATIG
RVSMDMLAVDLTDLPNEGIGSEVTLWGQGPHGAVLPIDEVARSAGTIGYELMCAVTRRVP
VHVETLG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtccgatcgaagccctcatccaccagcccgcgctggcccacaacatcgcccgc
gcccgcgcctgcgcgcccgacgcgcaggtgttcgcggtggtcaaggccaacgcctacggc
cacggcatcgagcgggccttcgacgcgctgcgcagcgccgacggcttcgcgatgctggac
ctggacgaggcccagcgcgtgcgcgacctgggctggcgcggcccgatcctgctgctggaa
ggctgcttcgagtcgcgcgacctggaactctgctcgcggctcaagctctggcacgcggtg
caccacgagcagcaggtcgactggctggccatgcacaagacccacgagccgcaccgcgtg
ttcctcaagctcaacagcggcatgaaccgcctgggcttcacgccgagcgccttccgcggc
gcctggacgcggctgaacgcgctgccgcaggtggacgagatctcgctgatgacgcacttc
tcggacgccgacggcccgcgcggcatcgcgcaccagaccgccgtcttcgcggaggcgacg
gccgatctgccgggcgcgcgcacgctgagcaacagcgccgcgatcctgcgccacagccag
gatccgacggtgcgcgccgactgggtgcgctcggggatcatgacctacggcagcgcgccg
gacttcccggagcacgacatcacccactgggacctgaagcccacgatgacgctgcgggcc
aaggtgctggcggtacagcagctgaaggaaggcgacagcgtcggctacggcagcagcttc
gtggcgcagcgcgcgatgcgcatcggcacggtggcctgcgggtacgcggacggttatccg
cgccacgccgcgcacggcacgccggtgctggtcggcggcaagcgcagcgcgacgatcggc
cgcgtgtcgatggacatgctggcggtcgacctgaccgatctgcccaacgagggcatcggc
agcgaagtcacgctctggggccagggcccgcacggcgcggtgctgccgatcgacgaggtg
gcgcgctcggccggcacgatcggctacgagctgatgtgcgcggtgacccggcgcgtgccg
gtgcacgtggagacgctgggctga

DBGET integrated database retrieval system