KEGG   Mitsuaria sp. 7: ABE85_23735Help
Entry
ABE85_23735       CDS       T04402                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
miu  Mitsuaria sp. 7
Pathway
miu00970  Aminoacyl-tRNA biosynthesis
miu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:miu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABE85_23735 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:miu03029]
    ABE85_23735 (gatB)
Enzymes [BR:miu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ABE85_23735 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ABE85_23735 (gatB)
Mitochondrial biogenesis [BR:miu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ABE85_23735 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ANH69842
UniProt: A0A1A9HSJ1
LinkDB All DBs
Position
complement(5399910..5401367)
Genome map
AA seq 485 aa AA seqDB search
MSKNSQLVRGYEVVIGLENHVQLSTASKIFSGSSTAFGAAPNTQASAVDLALPGTLPVLN
RGAVERAIRFGLSVGAKVAPLSIFARKNYFYPDLPKGYQISQYEIPVVQGGHIEFFVGDE
KKVVRLTRAHLEEDAGKSLHEDYHGQSGIDLNRAGTPLLEIVSEPEMRSGAEAVEYAKTL
HALVMWLGICDGNMQEGSFRCDVNVSVRKPNDPEFGTRREIKNLNSFRYLVDAVNYEVNW
QIDQIEDGLKIQQATVLYNPDTGETRAMRTKEDAADYRYFPDPDLPPLMISAEWVDRVRG
EMPELPTVMAARFQQADGLPAYDATMMTQSLATARFYEAARDLCGAPKLVANWVMGEVSR
RLNSEERGIASAPVTPAQLGALIKRIQDGTINNNAAKQVFEVLWTGEGADVDAIIDAKDL
KQSNDTGEIERILDEVLAANAKSVEEFRAGKEKAFNALVGQAMKAAKGKANPTTVNELLK
KKLGA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacagtcaactggtgcggggctacgaggtcgtcatcggcctggagaaccac
gtccaactctcgaccgcctcgaagatcttcagcgggtcgtcgaccgccttcggcgcggcg
cccaacacgcaggccagcgcggtggacctggcgctgcccggcacgctgccggtgctgaac
cgcggtgccgtcgagcgcgccatccgcttcggcctgtccgtcggcgcgaaggtggcgccg
ctgtcgatcttcgcgcgcaagaactacttctatccggacctgcccaagggctaccagatc
agccagtacgagatccccgtcgtgcagggcggccacatcgagttcttcgtcggcgacgag
aagaaggtcgttcggctcacccgcgcccaccttgaggaggacgccggcaagagcctgcat
gaggattaccacggccagtccggcatcgacctgaaccgcgccggcacgccgctgctggag
atcgtctcggagcccgagatgcgctccggcgccgaggccgtcgagtacgccaagacgctg
cacgcgctggtgatgtggctgggcatctgcgacggcaacatgcaggagggctcgttccgc
tgcgacgtgaacgtgtccgtgcgaaagcccaacgatcccgaattcggcacgcgccgcgag
atcaagaacctcaacagcttccgctacctggtggacgcggtgaactacgaggtcaactgg
cagatcgaccagatcgaggacggtctgaagatccagcaggcgacggtgctctacaacccg
gacacgggcgagacccgcgcgatgcgcacgaaggaagacgcggccgattaccgctatttc
ccggatccggatctgccgccgctgatgatctccgcggagtgggtcgaccgcgtgcgcggc
gagatgcccgagctgccgaccgtgatggccgcgcgcttccagcaggccgacgggctgccc
gcctacgacgcgacgatgatgacgcagagcctggcgacggcgcgcttctacgaagccgcg
cgggacctgtgcggtgcgcccaagctggtcgcgaactgggtgatgggcgaggtctcgcgc
cggctcaacagcgaggaacgcggcatagccagcgcgccggtgacgcccgcgcaactgggc
gcgctgatcaagcgcatccaggacggcacaatcaacaacaacgccgccaagcaggtgttc
gaggtgctgtggacgggcgagggcgccgatgtcgacgcgatcatcgacgccaaggacctg
aagcagtccaacgacaccggtgagatcgagcgcatcctcgacgaggtgctcgcagccaac
gccaagtcggtcgaggagttccgcgccggcaaggagaaggcgttcaacgcgctggtcggc
caggcgatgaaggcggccaagggcaaggccaatccgaccaccgtcaacgagttgctgaag
aagaagctcggcgcctga

DBGET integrated database retrieval system