KEGG   Mitsuaria sp. 7: ABE85_26550Help
Entry
ABE85_26550       CDS       T04402                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
miu  Mitsuaria sp. 7
Brite
KEGG Orthology (KO) [BR:miu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABE85_26550
Enzymes [BR:miu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ABE85_26550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin FAD_oxidored HI0933_like FAD_binding_2 AlaDh_PNT_C FAD_binding_3 DAO Thi4 NAD_binding_8 K_oxygenase FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ANH71061
UniProt: A0A1A9HTE6
LinkDB All DBs
Position
unnamed:229638..231191
Genome map
AA seq 517 aa AA seqDB search
MLDDNLKAQLKAYLERVTLPFEIEASLNDSESAAELKQLLQDITAMSDKITLNLNGNDAR
KPSFSLKRTGTEQSLRFAAIPLGHEFTSLVLALLWTGGHPPKVEQSTIDQIKGLDGDYLF
EVYMSLTCHNCPDVVQALSLMSVLNPRVKTVIVDGALFQDEVNAREIMAVPTIYLNGQEF
GSGRMTVEEIAAKLDTGAAEKDAAKLSAKEPYDVLIVGGGPAGAAAAVYAARKGIRTGIA
AERFGGQVNDTLAIENYISVLSTDGPKFSMALESHVKDYGVDVMNLQRGEALIPATTPGG
LVELKLANGGSLKSKTLIISTGARWKNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFGDQLRADAVLVKKLESLPNVVILKQAQTSEFTGTA
GKLDGLNYVDRATGESKRVEVEGVFVQIGLVPNTEWLRGTIELSKHGEIIVDAKGQTSVP
GVFAAGDATTVPFKQIIIAAGDGAKAALSAFDHIIRN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacaacctgaaggctcagctcaaggcctacctggagcgggtcacgctgccg
ttcgagatcgaagcctcgttgaacgactccgagagcgccgcagagctcaagcagctgctg
caggacatcaccgcgatgtccgacaagatcacgttgaacctgaacggcaacgatgcgcgc
aagccgtcgttcagcctgaagcgcacgggcaccgagcagagcctgcgcttcgccgcgatt
cccctgggccatgagttcacctcgctggtgctggccctgctgtggacgggcggccatccc
ccgaaggtggagcagtccaccatcgaccagatcaagggcctggacggcgactacctcttc
gaggtgtacatgtccctgacctgccacaactgcccggacgtcgtgcaggcgctgtcgctg
atgtcggtgctgaatccgcgtgtgaagacggtgatcgtggacggcgcgctgttccaggac
gaggtcaatgcccgcgagatcatggccgtgcccacgatctacctgaacggccaggaattc
ggctcgggccgcatgaccgtggaagagatcgccgccaagctggacaccggcgcggcggag
aaggacgcggccaagctgtcggccaaggaaccgtacgacgtgctgatcgtcggcggcggc
ccggccggcgcggcggcggcggtgtatgcggcccgcaagggcatccgcaccggcatcgcg
gccgagcgcttcggcggccaggtcaacgacacgctggcgatcgagaactacatctccgtg
ctgtcgaccgacggtccgaagttctcgatggcgctggaatcgcacgtcaaggattacggc
gttgacgtgatgaacctgcagcgcggtgaagcgctcattccggcgaccacgccgggcggc
ctggtcgagctgaagctggccaacggcggctcgctcaagagcaagaccctgatcatctcg
accggcgcgcgttggaagaacgtcaatgtgcccggcgagcaggaatacaagaacaagggc
gtggcctactgcccgcattgcgacggtccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcgggaactccggcgtcgaggcggcgatcgacctggccggcatcgtggcgcatgtg
acgctgctggaattcggcgatcagctgcgcgcggatgcggtgctggtgaagaagctggaa
agcctgccgaacgtcgtcatcctgaagcaggcgcagacgagcgagttcaccgggacggcg
ggcaagctggatggtctgaactacgtggatcgtgcgactggcgagagcaagcgcgtcgag
gtcgaaggcgtgttcgtgcagatcggcctggtacccaataccgagtggctgcgcggcacg
atcgagctgtccaagcacggcgaaatcatcgtcgacgcgaagggtcagacctcggtgccg
ggcgtgttcgctgcgggtgatgcgacgacggtgccgttcaagcagatcatcatcgcggcc
ggtgatggcgcgaaggcggcactcagcgccttcgaccacatcatcagaaactga

DBGET integrated database retrieval system