KEGG   Microvirga sp. 17 mud 1-3: C4E04_02810Help
Entry
C4E04_02810       CDS       T05470                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
miv  Microvirga sp. 17 mud 1-3
Pathway
miv00220  Arginine biosynthesis
miv01100  Metabolic pathways
miv01110  Biosynthesis of secondary metabolites
miv01130  Biosynthesis of antibiotics
miv01210  2-Oxocarboxylic acid metabolism
miv01230  Biosynthesis of amino acids
Module
miv_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:miv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    C4E04_02810
Enzymes [BR:miv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     C4E04_02810
    2.3.1.35  glutamate N-acetyltransferase
     C4E04_02810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ DUF1490
Motif
Other DBs
NCBI-ProteinID: AWM85774
UniProt: A0A2Z3I1I2
LinkDB All DBs
Position
complement(613812..615053)
Genome map
AA seq 413 aa AA seqDB search
MSKTVSPLAPKSYPTLPEIEGVRIATAEAGIRYKNRTDVLYVALAKETTVAGVFTRSKCP
SAPVDWCRKNLEKGVARALVVNSGNANAFTGRKGAEAVKLTADIAAKAAGCRASQVFIAS
TGVIGEPLDASKFAGVLETCEQKATPKAWVDAAKAIMTTDTFPKVATRTATIGGVEVTIN
GIAKGAGMIAPDMATMLSFVFTDAPLAAPVLQALLKKGADKSFNCVTVDSDTSTSDTLLF
FATGAAAKRGAPSIALPSDRRLKEFRQALESLLCDLARQVARDGEGARKFVTVKVTGATG
ATSAKRIAMAIANSPLVKTAVAGEDANWGRVVMAVGKAGEPAERDKLAIWFGDIRVAVKG
ARDPDYDEARTSTYMKGDDITIRVDLGLGRGESTVWTCDLTKAYVEINGDYRS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaccgtctcgccgctggcgcccaagtcctatcccacgcttcccgagatcgag
ggcgtcaggattgctacggcggaagccgggatccgatacaagaaccggacagacgtgctc
tacgtggccctcgccaaggagacgaccgtggcaggggtcttcacccgttcgaaatgcccg
tcggccccggtggactggtgccgcaagaacctggagaagggcgtcgctcgggcgctcgtg
gtgaattccggcaacgccaacgccttcacgggccggaagggcgcggaagccgtgaagctc
acggccgacatcgccgccaaggcggcgggctgccgcgcctcccaggtcttcatcgcctcg
acgggcgtgatcggcgagccgctcgatgcctcgaaattcgcgggcgtgctggagacctgc
gagcagaaggcgaccccgaaggcctgggtcgatgccgcgaaggccatcatgaccaccgac
accttcccgaaggtcgcgacccgcacggccaccatcgggggcgtggaggtcaccatcaat
ggcatcgccaagggcgcgggcatgattgctcccgacatggccaccatgctgtccttcgtc
ttcacggatgcgccgctcgcggcgccggtcctgcaggccctgctcaagaagggcgccgac
aagagcttcaactgcgtgacggtcgacagcgacacctcgacctcggatacgctcctgttc
ttcgccaccggcgccgccgccaagcggggcgcgccgtccatcgcgctgccgagcgaccgc
cgcctgaaggaattccggcaggccctcgagagcctgctctgcgaccttgcccggcaggtg
gcgcgggacggcgaaggggcgcgcaagttcgtgaccgtgaaggtgaccggcgccaccggc
gccacctcggcgaagcgcatcgccatggcgatcgccaactcgcccctcgtgaaaaccgct
gtggccggcgaggacgccaattggggccgcgtcgtgatggcggtcggcaaggccggcgag
ccggcggagcgcgacaagctcgcgatctggttcggcgacatccgcgttgccgtgaagggc
gcccgggacccggattacgacgaggcccggacctccacctacatgaagggcgatgacatc
acgatccgggtcgatctcggcctcggccgcggcgagtccaccgtgtggacctgcgacctc
accaaggcctatgtggagatcaatggcgattaccggagctga

DBGET integrated database retrieval system