KEGG   Microvirga sp. 17 mud 1-3: C4E04_02860Help
Entry
C4E04_02860       CDS       T05470                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
miv  Microvirga sp. 17 mud 1-3
Pathway
miv00473  D-Alanine metabolism
miv00550  Peptidoglycan biosynthesis
miv01100  Metabolic pathways
miv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:miv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C4E04_02860
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C4E04_02860
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C4E04_02860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:miv01011]
    C4E04_02860
Enzymes [BR:miv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C4E04_02860
Peptidoglycan biosynthesis and degradation proteins [BR:miv01011]
 Precursor biosynthesis
  Amino acid ligase
   C4E04_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AWM85784
UniProt: A0A2Z3I1J1
LinkDB All DBs
Position
complement(624589..625686)
Genome map
AA seq 365 aa AA seqDB search
MTHTRRTVGLMFGGCSAEHDVSRMSAANVLRALDPAKYDIVPIGIRRDGRWFLGNSAPPD
AKSLEIPSGAPEVVLPPGRNGELVALSGGTGPIRLDIAIPVLHGPNGEDGSVQGLLELAN
LAYVGSGVMGSAACMDKDVAKRLLRDADLPIVPFLTITRQNRVDYEAAAKALGTTDLFVK
PANMGSSVGVSPARSAEDFVRACDLAFGHDTKILVERSVSGAREIECSVLEEASGTLRAS
PLGEIAPAQSHGFYSYTAKYEDAAGADLRIPAALDRALSDRIRDLALAAFRVLGCESLAR
VDFFVDPEDPAGVYINEINTLPGFTAISMYPKLWEAAGLTQRDLMDALIGHALSRHDRKR
ARESA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgactcatacgcgcagaaccgtcgggctcatgttcggcggatgctcggcagagcatgac
gtctcccggatgtcggccgccaacgtgctgcgcgccctggatcctgcgaaatacgacatc
gtgcccatcgggatccgccgggacgggcgatggttcctcggcaactccgccccgccggac
gcgaaatccctcgaaatcccctccggcgcccctgaagtcgtgcttccgcccggccgcaac
ggcgagctcgttgccctgagcggcgggaccggccccatccgtctcgacatcgcaatcccg
gtcctgcatgggccgaacggggaagacggctccgtccagggattgctggaactcgcgaac
ctcgcctatgtgggctcgggcgtcatgggctcggcagcctgcatggacaaggacgtcgcc
aagcgcctgctgcgcgacgctgacctgcccatcgtcccgttcctgaccataacccgacag
aaccgggtggattacgaggctgccgccaaagcgctcggcaccacggacctcttcgtcaag
ccggccaatatgggctcgtcggtgggcgtgtcccctgcccgctcggcggaggatttcgtc
cgggcctgcgacctggccttcggccacgacaccaagatcctcgtagaaagaagcgtctcg
ggagcgcgggagatcgaatgctccgtcctggaggaggcctccggcacgctgcgcgcctcc
ccgctcggcgagatcgctccggcgcaatcccacggcttctacagctacaccgccaaatac
gaggatgcggcgggcgccgaccttcgcatcccggcagctctcgaccgggccctctccgac
cgcatccgggacctcgccctcgcggccttccgcgtgctcggctgtgaaagcctggcgcgg
gtcgacttcttcgtcgacccggaggatccggcgggcgtttacatcaacgagatcaacacc
ctgccgggttttacggcgatcagcatgtatcccaagctgtgggaggccgcaggcctgacc
cagcgtgacctgatggatgccctgatcggccatgccctgtcccggcacgaccggaaacgg
gcccgggaaagcgcctga

DBGET integrated database retrieval system