KEGG   Microvirga sp. 17 mud 1-3: C4E04_06585Help
Entry
C4E04_06585       CDS       T05470                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
miv  Microvirga sp. 17 mud 1-3
Pathway
miv00473  D-Alanine metabolism
miv00550  Peptidoglycan biosynthesis
miv01100  Metabolic pathways
miv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:miv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C4E04_06585
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C4E04_06585
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C4E04_06585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:miv01011]
    C4E04_06585
Enzymes [BR:miv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C4E04_06585
Peptidoglycan biosynthesis and degradation proteins [BR:miv01011]
 Precursor biosynthesis
  Amino acid ligase
   C4E04_06585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 GARS_A ATP-grasp ATPgrasp_ST CbiA ATPgrasp_TupA
Motif
Other DBs
NCBI-ProteinID: AWM86437
UniProt: A0A2Z3I8V3
LinkDB All DBs
Position
1417462..1418385
Genome map
AA seq 307 aa AA seqDB search
MAKHVAVLHGGWSAEREVSLASGRACARALEERGYKITPIDVQPDIATVLQATAPDVVFN
ALHGRVGEDGTIQGLLEILRIPYTHSGVLASALAMQKDRAKTVMQAAGVPVPRGVVVNRL
DAARAHVLPAPYVIKPVSEGSSVGVIIVREERSHPPQELLREDWAFGEQVLVESYVAGRE
LTCAVMGDQALGVIEIKPATGVFYDYDAKYVKGGSIHVLPAEIKPNIYQKVQELALTAHQ
ALGCRGISRADLRYDDTPGGTGELVVLEVNTQPGMTETSLVPELAAHAGYSFGELVQWMV
EDATCNR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcacgttgccgtcctccatggcggctggtccgcagagcgcgaagtcagcctg
gcgtcgggccgcgcctgtgcccgggcgctggaagagcgtggctacaagatcacgcccatc
gacgtgcagcccgacatcgccaccgttctccaggcgacggcgccggacgtggtcttcaac
gccctgcacggccgggtgggcgaggacggcacgatccagggcctcctcgaaatcctgcgc
atcccctacacccattcgggcgtcctcgcctcggcgctcgccatgcagaaggaccgggcc
aagacggtcatgcaggcggccggggttccggtcccgcgcggcgtggtcgttaaccgtttg
gacgcggccagggcccatgtgctgcccgcgccctacgtgatcaaaccggtcagcgagggc
tcgtccgtgggcgtcatcatcgtgcgcgaggagcgcagccatccgccccaggagctgctt
cgggaagattgggccttcggtgagcaagtccttgtggaatcgtatgttgcgggccgggag
ctgacctgcgctgtcatgggcgaccaggcgctgggcgtcatcgagatcaagcccgccacg
ggcgtgttctacgactatgacgcaaagtacgtgaagggaggctccattcacgtcctcccg
gcagaaattaaaccgaatatttaccaaaaggtccaagagttggcgttaacggcgcatcaa
gcgctcggctgtcggggaatcagccgcgccgacttacggtatgacgacacgcccggtgga
acgggtgaactcgttgttcttgaggtcaatacgcaacccggcatgaccgagacgagcttg
gtgccagaactggcagcccatgcgggctattcgtttggcgagcttgtgcaatggatggtg
gaggacgctacctgcaaccgatga

DBGET integrated database retrieval system