KEGG   Microvirga sp. 17 mud 1-3: C4E04_10345Help
Entry
C4E04_10345       CDS       T05470                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
miv  Microvirga sp. 17 mud 1-3
Pathway
miv00010  Glycolysis / Gluconeogenesis
miv00030  Pentose phosphate pathway
miv00051  Fructose and mannose metabolism
miv00052  Galactose metabolism
miv00680  Methane metabolism
miv01100  Metabolic pathways
miv01110  Biosynthesis of secondary metabolites
miv01120  Microbial metabolism in diverse environments
miv01130  Biosynthesis of antibiotics
miv01200  Carbon metabolism
miv01230  Biosynthesis of amino acids
Module
miv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:miv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C4E04_10345
   00030 Pentose phosphate pathway
    C4E04_10345
   00051 Fructose and mannose metabolism
    C4E04_10345
   00052 Galactose metabolism
    C4E04_10345
  09102 Energy metabolism
   00680 Methane metabolism
    C4E04_10345
Enzymes [BR:miv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     C4E04_10345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AWM87096
UniProt: A0A2Z3I8X0
LinkDB All DBs
Position
complement(2184405..2185349)
Genome map
AA seq 314 aa AA seqDB search
MKRIVTLTLNPAIDGAEEAEQVRPIRKIRTWAERYDPGGGGINAARVIEELGGSALAIYL
SGGTTGPILDALVQAAGIESRRIPIAGHTRISHTVHETSSGLEFRFVPGGPSVTREEWQA
CLAALEDIDGDYLLASGSLPRGVPNDFYGQVAALAARRGMRFVLDTSGDALRQAAGKGLF
LIKPSLGELEDLVGRTLPTPQDQDSAVRDLIAAGTAEIIALTLGRDGAVLATGDTLLRIE
GVKVTPKSAVGAGDSFLGAMTLGLAQGRPVEEAFTLGMAAGTAAVLTAGTELCRRADVER
LYEEIRRGQTSAGA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattgtgaccttgaccctcaatcctgccatcgacggagcggaggaggccgag
caggttcggcccattcgcaagatcaggacctgggccgaacgctacgatcccggcggcggc
ggcatcaatgcggcacgagtgatcgaggaattgggaggatcggcgctcgcgatctacctt
tcgggcgggacgacaggcccgatcctcgatgcgttggttcaggccgccgggatcgagagc
cggcggattcccatcgccggccacacccgcatcagccacaccgtccacgagacctcgtca
gggttggaattccgcttcgttcccggagggccgagtgtgacacgggaggagtggcaggcc
tgcctagcggcgctcgaagacattgacggcgactatctgctggcgagcggaagccttccg
cgcggtgttcccaacgatttctacgggcaggtcgcggctcttgcagcccgccggggcatg
aggttcgtgctcgacacgtcgggcgacgcgctccggcaggcggccggcaaggggctcttc
ctaatcaagccgagcctcggcgaactggaggatctggtcggccgcacgctccccacgcca
caggaccaggactccgccgtgcgggatctcatcgccgccggcactgcggagatcatcgct
ctgaccctggggcgcgatggggccgtgctggcaaccggcgacacgctcctgcggattgag
ggggtgaaggtcacgccgaagagcgccgtcggcgccggcgacagcttcctcggcgcgatg
acgctcggtcttgcccaaggcaggccggtggaagaggccttcaccttgggcatggcagcc
ggaaccgccgcggttttgacggcgggcacggaactgtgccggcgggccgatgtggagcgc
ctctacgaagagatcagacgcggtcaaacgagtgcgggcgcctga

DBGET integrated database retrieval system