KEGG   Microvirga sp. 17 mud 1-3: C4E04_14985
Entry
C4E04_14985       CDS       T05470                                 

Definition
(GenBank) 3-methyladenine DNA glycosylase 2
  KO
K13529  AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
miv  Microvirga sp. 17 mud 1-3
Pathway
miv03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:miv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    C4E04_14985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:miv03000]
    C4E04_14985
   03400 DNA repair and recombination proteins [BR:miv03400]
    C4E04_14985
Enzymes [BR:miv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     C4E04_14985
Transcription factors [BR:miv03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    C4E04_14985
DNA repair and recombination proteins [BR:miv03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     C4E04_14985
SSDB
Motif
Pfam: AlkA_N Ada_Zn_binding HTH_18 HTH_AraC HhH-GPD
Other DBs
NCBI-ProteinID: AWM87912
UniProt: A0A2Z3IF95
LinkDB
Position
3175708..3177195
AA seq 495 aa
MTNLDPAACYRALQSRDRRFDGRLFVGVTSTGIYCRPICPASTAKFENCRFYPSAAAAQE
AGFRPCLRCRPETAPDLGSWRGTSNTVSRGLALIAEGALDGEEASVEALASRLGIGERQL
RRLFQEHLGVSPLAVAQTRRILFAKQLIHDTRLPMSEIALAAGFGSVRRFNETFQALYRR
PPSAIRKRSVNALPEGSAATTGVTVRLRYRAPYDWDAMLAFLKARAIDGVERVEGGVYRR
TVLHEGMTGTVAVSHLAEKESLEAVIRFPGVQALPSIVARVRRVFDLGADVMTVTSHLAQ
DPQLAPLVTARPGLRVPGGWDGFEVAMRAILGQQVSVEAGRQLGSRLTRICGTPFPESQA
QNDDLTLAFPTAAQVLAADISSLGMPNARKAALKAVAEAAVAEPDLFRPLGTVEETVARL
SAIRGIGEWTAHYIALRAVREPDAFPASDIGLLRGAAGRDGARPSPAELQKRAEAWRPWR
AYAAQHLWAADEKSA
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgacgaatcttgaccccgccgcctgctacagagccctgcaatcccgcgaccggcgcttc
gacgggcgcctcttcgtgggtgtcacgtccacggggatctattgccgccccatctgcccg
gcgagcacggccaagttcgagaattgccggttctatccctcggcagccgccgcccaggag
gcgggctttcgcccctgcctgcgctgccggcccgagactgcgcccgatctcgggtcctgg
cgcggcacctcgaatacggtctcgcgggggctcgccctcatcgcggaaggtgccctcgac
ggcgaggaggcgagcgtcgaggcgctggcctcgcggcttggcatcggtgagcgccagctg
cgccgcctcttccaggaacatctgggcgtctcgcccctcgcggtcgcgcagacccggcgc
attctcttcgccaagcagctaatccacgacacacgcctgcccatgtccgagatcgcgctg
gccgcgggcttcggcagcgtgcgccgtttcaacgagaccttccaggcgctctaccgccgg
ccgccgagcgcgatccgcaagcgcagtgtgaacgcgctgcccgaaggatcagccgcgacc
acgggcgtgaccgtccggctgcgctaccgggccccttacgactgggacgccatgctggcc
ttcctcaaggctcgtgccatcgacggggtggaacgggtcgaggggggcgtctatcgcagg
acggtcctgcacgagggcatgaccggcacggtggcagtgtcccatctggccgagaaggag
agcctggaggcggtcatccgcttccccggcgtccaggccctgccgtccatcgtggcgcgc
gtgcggcgcgtcttcgatctcggcgccgacgtgatgaccgtaacgagccacctggcgcag
gatccgcagctcgcccctctcgtcaccgcgcggccgggcctgcgcgtcccgggcggctgg
gacgggttcgaggtcgccatgcgggcgatcctcggccaacaggtttccgttgaggcaggc
cgacagctcggcagcaggctcacgcggatctgcggcacgccgtttccggaaagccaggcc
cagaacgacgacctcaccctcgcattcccgaccgccgcccaggtgttggctgcggatatc
agctccctcggcatgcccaacgcccgcaaagccgccctgaaggcggtagcggaggccgcg
gtggcggagccggacctgttccggccgctcggcaccgtggaggagacggtcgcgcggctc
agcgccatccgcggcatcggcgaatggacggcccattacatcgccctgcgggccgtgcgg
gagccggatgcctttccggccagcgatatcggcctgctgcgcggcgctgccgggcgggac
ggcgcccgcccctccccggcggagctgcagaagcgcgccgaggcttggcgcccctggcgc
gcctatgcggcgcagcacctctgggcggccgacgagaagagcgcctga

DBGET integrated database retrieval system