KEGG   Microvirga sp. 17 mud 1-3: C4E04_19750Help
Entry
C4E04_19750       CDS       T05470                                 

Definition
(GenBank) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
miv  Microvirga sp. 17 mud 1-3
Pathway
miv00061  Fatty acid biosynthesis
miv00780  Biotin metabolism
miv01100  Metabolic pathways
miv01212  Fatty acid metabolism
Module
miv_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:miv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C4E04_19750
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C4E04_19750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:miv01004]
    C4E04_19750
Enzymes [BR:miv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C4E04_19750
Lipid biosynthesis proteins [BR:miv01004]
 Fatty acid synthase
  Component type
   C4E04_19750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AWM88735
UniProt: A0A2Z3IQD7
LinkDB All DBs
Position
complement(4206561..4207022)
Genome map
AA seq 153 aa AA seqDB search
MRLEYFEMIDRVTRLDREGRRIEATSTVPTESPVFEGHFPGHPLVPGVLLTETMAQASGY
LVLGLMNFTHMPFLMAVDKARFRTFVGPDTVLTVTAQLEHEGSGYAVTKAKIMAEGKPIC
DAELRFRIMPFPAGMDELMRAQARRIGLLAEAA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcgaatattttgaaatgatcgatcgggtgacgcgcctcgaccgcgagggccgc
cggatcgaggccacgtccacggtgccgacggaaagcccggtcttcgaagggcatttcccg
ggtcatcccctggtgcccggcgtgctgctcaccgagaccatggcccaggcctccggctat
ctcgtgctggggctcatgaacttcacccacatgccgttcctcatggcggtcgacaaggcg
cgctttcgcaccttcgtcggacccgatacggtgctcaccgtcacggcgcagctcgagcac
gagggctcgggctatgcggtcacgaaggcgaagatcatggccgagggcaagcccatctgc
gatgcggagctgcgcttccgcatcatgcccttcccggccggcatggacgagctgatgcgg
gcccaggcgcgccgcatcgggctcttggcggaggcggcctga

DBGET integrated database retrieval system