KEGG   Microbacterium sp. XT11: AB663_000114Help
Entry
AB663_000114      CDS       T04243                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mix  Microbacterium sp. XT11
Pathway
mix00250  Alanine, aspartate and glutamate metabolism
mix00280  Valine, leucine and isoleucine degradation
mix00310  Lysine degradation
mix00410  beta-Alanine metabolism
mix00640  Propanoate metabolism
mix00650  Butanoate metabolism
mix01100  Metabolic pathways
mix01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mix00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AB663_000114
   00650 Butanoate metabolism
    AB663_000114
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AB663_000114
   00280 Valine, leucine and isoleucine degradation
    AB663_000114
   00310 Lysine degradation
    AB663_000114
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AB663_000114
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mix01007]
    AB663_000114
Enzymes [BR:mix01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AB663_000114
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AB663_000114
    2.6.1.48  5-aminovalerate transaminase
     AB663_000114
Amino acid related enzymes [BR:mix01007]
 Aminotransferase (transaminase)
  Class III
   AB663_000114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALX65571
UniProt: A0A0U4GHT7
LinkDB All DBs
Position
complement(107924..109285)
Genome map
AA seq 453 aa AA seqDB search
MALLDTAAVAVPLGGPDLPQERRLVTELPGPRSAEILARKADAVAAGVGHTVPVAAVAAG
GGVVVDADGNSLIDLGSGIAVTTVGNAHPKVAAAVAAQAAQFTHTCFMISPYESYVGVAE
ALNRITPGDFAKKSALFNSGAEAVENAIKIARKHTGRQAVVAFDHGYHGRTNLTMALTAK
SMPYKSGFGPFAPEVYRATASYPFRDGLSGAEAAARAILQLEKQIGADNLAAVIIEPIQG
EGGFIVPADGFLPAIVDWCRDNGVVFIADEVQTGFARTGAMFASEIFGIEPDLITTAKGI
AGGLPLAAVTGRAEIMDASHTGGLGGTYGGNPIACAAALATIDVFENDGMLDRAREIGEI
LLGRLTAMQQDDPRIGDVRGHGAMVAAEFVDPETKAPDAALTAAVAKACIAQGVIVLTCG
TYGNVIRFLPPLSISDDLLNEGLDIVSAALAAA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcactcctcgacaccgcagctgttgcagtccccctcggcggtcccgacctcccgcag
gagcgtcgcctcgtcaccgaacttcccggccctcgatcggccgagatcctcgcccgcaag
gcggatgccgtcgccgccggcgtcggacacaccgttcctgtcgccgcggtcgccgcgggc
ggaggagtcgtcgtcgacgccgacggcaactcgctcatcgacctcggcagcggcatcgcc
gtcaccacggtcggcaacgcgcatcccaaggtcgccgccgccgtcgccgcgcaggccgcg
cagttcacgcacacctgcttcatgatctcgccctacgagtcgtacgtgggcgtcgccgag
gcgctcaaccgcatcacgcccggcgacttcgccaagaagagcgcgctgttcaactccggc
gccgaggcggtcgagaacgcgatcaagatcgcccgcaagcacaccggccgccaggccgtc
gtggccttcgaccacggctaccacggccgcacgaacctgaccatggcgctgaccgccaag
tcgatgccctacaagagcggcttcggaccgttcgcccccgaggtgtaccgcgccaccgcg
tcgtaccccttccgcgacgggctcagcggcgcggaggctgcggcccgcgcgatcctccag
ctcgagaagcagatcggcgccgacaacctcgccgccgtcatcatcgagccgatccagggc
gagggcggcttcatcgtccccgccgacggcttcctccccgcgatcgtcgactggtgccgt
gacaacggcgtcgtcttcatcgccgacgaggtgcagaccggattcgcccgcaccggtgcg
atgttcgccagcgagatcttcggcatcgagcccgacctcatcaccacggcgaagggcatc
gccggcggcctgccgctcgccgcggtcaccggccgcgccgagatcatggatgcgtcgcac
acgggtggcctcggcggcacctacggcggcaaccccatcgcgtgcgccgccgctctcgcg
acgatcgacgtgttcgagaacgacggcatgctcgaccgtgcgcgggagatcggcgagatc
ctgctcggccggctcaccgcgatgcagcaggacgacccgcgcatcggtgacgtccgaggc
cacggcgcgatggtcgccgccgagttcgtcgacccggagaccaaggcccccgacgccgcg
ctcaccgcggccgtcgcaaaggcctgcatcgcgcagggcgtcatcgtgctcacctgcgga
acctacggcaacgtcatccgcttcctcccgccgctgtcgatcagcgacgacctgctgaac
gagggcctcgacatcgtgtcggccgccctcgccgcggcctga

DBGET integrated database retrieval system