KEGG   Microbacterium sp. XT11: AB663_003164Help
Entry
AB663_003164      CDS       T04243                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mix  Microbacterium sp. XT11
Brite
KEGG Orthology (KO) [BR:mix00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AB663_003164
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mix03400]
    AB663_003164
Enzymes [BR:mix01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AB663_003164
DNA repair and recombination proteins [BR:mix03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AB663_003164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ALX67286
UniProt: A0A0U4GKT0
LinkDB All DBs
Position
3226693..3229095
Genome map
AA seq 800 aa AA seqDB search
MPADAHMVQIGGRRLRVTNLQKVVYPETGTTKGEIIAYYTQVAPALLPLLAGRPVTRKRW
VDGVGTADAPAEAFFTKQLERGAPSWIPRQEIRHSDGPKEYPLVEDVPTLVWLAQVAAIE
LHVPQWRFTPDGLPGNPDRLVLDLDPGPGVGLAQCAEVARIARGILTGMGLDPFPVTSGS
KGIHLYAALPGAQTSDEISAVVKELARLIENDHPDLATSTMAKVARGGKVFLDWSQNNGK
KTTISPYSLRGRSRPWVAAPRTWDELEDPDLRHLEMAEVLERLAAGADPIADLRPRGDEL
LAAYRAKRDADRTPEPMPERVASVSTGLTRRFVIQEHHARRLHYDLRIEDKGVLVSWAVP
KGVPESTERNHLAVMTEPHPLEYLTFSGTIPAGEYGAGEMSIWDTGTVALEKWRDDEVIG
TFTGREGGPLPGVRLALIRTTGEGEKSSWLLHRMKDGTEPRRKGAPRAAPERQPADRSTV
APLDPMLAENGTPALARALGSPAWVEVKWDGIRAIGSWEDGRMRLHARSGTDITARYPEL
TADGAPHLPVGDAVLDGEIVAFDTRGRPSFSLLQNRMHLTRPREIEREAVRTPTVYLVFD
LLRLDGHDLTSMPLAQRRTLLEDVVADLEAPVQAPPVFDDVDAALAASREFGLEGVVVKG
RESRYRPGQRSPSWLKVKNTRMQEAVIVGIRPGKGDRAGTIGSLLLAVPDTDGLRYIGRV
GTGFTDRMLRDLDRQLTPLRVPRAPLSGVPRPDAADALWVRPDLVGEVEFANWTPDGILR
HARWRGLRPDKAPDEVTVEA
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagacgcgcacatggtccagatcggcggacgacgcctgcgcgtcacgaatctg
cagaaggtcgtctaccccgagaccgggacgaccaagggcgagatcatcgcgtactacacg
caggtcgcccccgcgctcctcccgctgctggccgggcgccctgtcacgcgcaagcgctgg
gtggacggcgtcggcacagcggatgctccggccgaagcgttcttcacgaagcagctcgag
cggggtgcaccctcgtggatcccgcggcaggagatcaggcactcggacggaccgaaggag
tatccgctcgtggaggacgtgccgacgctcgtctggctcgcccaggtcgcggcgatcgag
ctccacgtgccgcagtggcggttcactcccgacgggctgcccggaaatccggaccgcctc
gtcctggatctcgaccccggccccggcgtcggactcgcccagtgcgcggaggtcgcgcgg
atcgcacgcggcatcctcaccggcatgggcctggatcccttccctgtgacgagcgggagc
aagggcatccacctctatgccgccctccccggtgcgcagaccagcgacgagatctccgcc
gtggtgaaggagctcgcgcggctcatcgagaacgaccatcccgatctcgccacgagcacc
atggccaaggtcgcccgcggcggcaaggtgttcctcgactggagccagaacaacggcaag
aagacgaccatctccccgtactcgctgcgcgggcggtcccgcccctgggtggccgcgccg
cgcacatgggacgagctcgaggaccccgacctgcgccacctggagatggcggaggtcctg
gagcgcctggccgcaggagccgacccgatcgcggatctgcgcccgcgcggcgacgagctc
ctggccgcgtaccgcgccaagcgcgacgccgaccgcactcccgagccgatgccggagcgg
gtggcatccgtgagcaccggcctgacgcggcgcttcgtcatccaggagcaccacgcgcgg
cggctgcactacgacctgcgcatcgaggacaagggcgtgctggtgagctgggcggtgccg
aagggcgtgcccgaatcgaccgagcgcaaccacctcgccgtgatgaccgaaccgcatccg
ctcgagtacctcaccttctccggcaccatccccgccggcgagtacggggcgggagagatg
tccatctgggacaccgggaccgtcgcactcgagaagtggcgagacgacgaggtgatcggc
accttcactgggcgcgagggagggccgcttcccggtgtgcgcctcgccctcatccgcacg
acgggcgagggcgagaagtcgtcgtggctgctgcaccggatgaaggacggaaccgagccg
cgccgcaagggggcgcctcgagcggcaccggagaggcagcccgcggacaggagcacggtg
gcgcctctcgatcccatgctcgccgagaacggcacgcccgcgctcgcgcgagccctcgga
tcgcccgcatgggtggaggtgaagtgggacggcatccgcgccatcggcagctgggaggac
ggacggatgcggctgcacgcccgcagcggcaccgacatcacggctcgctaccccgagctc
accgccgacggcgcgccgcacctccccgtcggcgacgccgtgctcgacggggagatcgtg
gcgttcgacacccgggggcgccccagcttctcgctgctgcagaaccggatgcacctcacc
aggccgcgcgagatcgagcgcgaggcagtgcggacgccgaccgtgtacctggtcttcgac
ctgctgcggctcgacggtcacgatctgacctccatgccgctcgctcagcgtcgcacgctt
ctcgaggatgtggtcgcggaccttgaggcgccggtgcaggccccgcccgtgttcgacgac
gtcgacgccgccctcgccgccagccgggagttcggtttggaaggcgtggtcgtcaagggc
cgcgagtcgcggtaccgcccaggccagcgctcaccatcgtggctcaaggtcaagaacacg
cgcatgcaggaggccgtgatcgtcggcatccgcccgggcaagggcgaccgcgccggcacg
atcggctcccttctcctcgccgtgcccgacaccgacggcctccggtacatcggccgcgtc
ggcaccgggttcaccgaccggatgctgcgcgacctggatcgtcagctcacccctctgcgc
gtgccacgcgcgccgctcagcggagtcccgcgcccggatgccgccgatgcactgtgggtg
cgacccgatctcgtcggcgaggtggagttcgcgaactggacgcccgacgggatcctacgg
cacgcacggtggcgagggctgcgcccggacaaggctcccgacgaggtcaccgtcgaggca
tga

DBGET integrated database retrieval system