KEGG   Mycobacteroides immunogenum: BAB75_01780Help
Entry
BAB75_01780       CDS       T04755                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
miz  Mycobacteroides immunogenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANO06634
UniProt: A0A0N0KNE4
LinkDB All DBs
Position
complement(354170..355234)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPIAPMLAKPVAKIPADASYEPKWDGFRSIVFRDGDEVELGSRNEKPLTRYFPE
LVAAVRAELPPRCVIDGEIVIATAAGLDFEALQQRIHPADSRVRLLAEQTPSSFIAFDLL
ALGDEDYTVRPFSERRAALTGALSGAGTSIHLTPATTDQAVAQRWFEEFEGAGTDGLIAK
PLTIAYQPDKRVMFKIKPERTADCVVAGYRVHKSGNDAIGSLLLGLYQDDGALASVGVIG
AFPMAERKRLFQELQPLVTALENHPWNWAAHEAGERTPQKNAGSRWNAGKDLSFVALRPE
RVVEVRYDHMEGVRFRHTAQFNRWRPDREPRSCTYEQLERPIAFSLNDIVPGLV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgccgccaatcgcgccaatgctcgccaaacctgtcgcaaaaatt
ccggctgacgcctcctacgagcccaagtgggatgggttcaggtcgatcgtgtttcgtgac
ggcgacgaggtggagctgggcagccgcaacgaaaagccgctgacccggtactttcccgag
ctggtggcggcggttcgcgccgaactaccaccgcgatgtgtcatcgacggcgagatcgtg
atcgccacggcggcagggcttgatttcgaggcactgcaacagcggatccatccggcagat
tcacgagtcaggctgctggccgagcagacgccctcctccttcatcgcgttcgatctgctg
gcactgggcgacgaggactacaccgtgcgtccgttcagtgagcggcgcgccgcgctgacc
ggcgcgctgtccggggccggcacctcgatccacctaacccccgccaccaccgatcaggcc
gtggcacagcgctggttcgaggaattcgagggcgccggcaccgacggcctcatcgcgaag
ccattgaccattgcctaccaacccgacaagcgggtgatgttcaagatcaagccggagcga
accgccgattgtgtggtcgccggatatcgggtgcacaaatccgggaacgacgccatcgga
tcgctgctactggggctgtaccaggacgatggcgcactggcctcggtaggcgtgatcggc
gcgttcccgatggccgagcgcaagcgcctgttccaggagctgcagccattggtcaccgct
ctggagaatcatccgtggaactgggccgcccacgaggccggcgagcgcaccccgcagaag
aacgccggctctcgctggaacgccggtaaagatctgtccttcgtcgcgctgcgcccggaa
cgggtggtggaggtgcgctatgaccatatggagggcgtgcggttccggcataccgcgcag
ttcaaccgctggcgcccggaccgcgaacccagatcgtgcacgtatgaacagcttgagcgg
ccgatcgccttcagcctcaacgatattgttccgggcctggtgtga

DBGET integrated database retrieval system