KEGG   Mycobacteroides immunogenum: BAB75_01785Help
Entry
BAB75_01785       CDS       T04755                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
miz  Mycobacteroides immunogenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ANO06635
UniProt: A0A0N1LWY7
LinkDB All DBs
Position
355253..356281
Genome map
AA seq 342 aa AA seqDB search
MPTPAEELDVDGIAVRLSNPDKVYFPELGAEGGTKRHLAEYYRTVALGPMMSAVRNRPTH
LQRFPDGIDGEEIYQKRLPKHFPDYLDSCEVTFPSGRTAEVLRVTKPAAIVWAAQMGTVT
MHPWQVRYPDLDHPDELRIDLDPQPGTGFDEAKAVALDVLRPLLDELGFVAYPKTSGGRG
IHVYLRVEPRWDFIEVRRAGIALAREVERRAPQQVTTSWWKEERGERIFIDFNQNARDRT
MASAYSVRRTPIATVSTPLTWDELVDAEPDDFTIATVPELLRKRPDPMADMDDLPQSIEP
LLEMVERDEANGLGDMPYPPNYPKMPGEPKRVQPSRDTDRKQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcccgccgaggaactggatgtcgacggcatcgccgtccgattgagcaaccct
gacaaggtgtatttccctgagttgggggccgagggcggcaccaagcgccatctcgcggag
tactaccggaccgtcgcgctgggtccgatgatgagcgcggtgcgaaaccgtcccacccat
ctgcagcgcttccccgacggcatcgacggcgaagagatttaccaaaagcggctgccgaag
cactttcctgattacctggacagttgcgaagtcacctttccctccgggcgcaccgccgag
gtgctacgggtgaccaagcccgccgcgatcgtgtgggcggcgcaaatgggcaccgtgacg
atgcatccgtggcaggttcgctacccggatctggatcatccggatgagctgcgcattgac
ttggacccgcagccgggaaccggattcgacgaggccaaggcggtcgcgcttgatgtgttg
cgcccgctgctggacgaactgggatttgtcgcctatccgaaaacatccgggggccgcggt
atccacgtgtatctgcgcgtcgaaccgcgctgggacttcatcgaggtgcgccgcgccggt
atcgcgctggcccgcgaggtggaacgccgcgcacctcagcaggtgaccacgtcatggtgg
aaggaagaacgcggggagcgcatcttcatcgacttcaaccaaaacgcccgcgaccgcacc
atggcctcggcgtactcggtgcgacgcacccccatcgccactgtctccaccccgttgacg
tgggacgaactcgtcgatgccgaacccgatgatttcaccatcgcgaccgttcccgagctg
ctgcgcaaacggccagaccccatggcggatatggacgatctgccgcagtcgatagagccg
ctgctcgagatggtagaacgggatgaggcgaacggattgggtgatatgccctatccgccc
aactacccgaagatgccgggagaaccgaaacgcgttcagccgtcccgggataccgatagg
aagcagtag

DBGET integrated database retrieval system