KEGG   Mycobacteroides immunogenum: BAB75_17545Help
Entry
BAB75_17545       CDS       T04755                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00473  D-Alanine metabolism
miz00550  Peptidoglycan biosynthesis
miz01100  Metabolic pathways
miz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAB75_17545
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAB75_17545
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BAB75_17545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:miz01011]
    BAB75_17545
Enzymes [BR:miz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BAB75_17545
Peptidoglycan biosynthesis and degradation proteins [BR:miz01011]
 Precursor biosynthesis
  Amino acid ligase
   BAB75_17545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: ANO04910
UniProt: A0A0N1CML0
LinkDB All DBs
Position
complement(3560902..3562038)
Genome map
AA seq 378 aa AA seqDB search
MNDSVARSRADQQRIKVALVFGGRSSEHAISCVSAGSILRNLDPLAYEVVAVGVTPEGGW
VLTDGDPSRLAISDRTLPQVTDASGTELVLATDPRRAGQLVNVDSAAAGQVLASVDVVFP
VLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLAAEGLPIGKYAVIRPR
DASLTLDQREELGLPVFVKPARAGSSFGVSRVTAWEELPAAIAHARRFDPKVIVEAAIIG
RELECGVLEFPDGDIRASVLGEIRVEGVRGREDGFYDFETKYLDDTAELDVPAKVDDDVS
DQIRELAVAAFRAIDCQGLARVDFFLTEDGPLINEINTMPGFTTISMYPRMWAATGVDYP
ALLDAMVRTALARGTGLR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgactcggtggcccgctcgcgcgcagaccaacagcggatcaaggtcgcgctcgtc
tttggtggacgcagcagcgagcacgcgatttcctgcgtgtccgccggcagcattctgcgc
aatcttgacccgctcgcctacgaggtggtcgcggtaggggtgacgcccgagggcggctgg
gtgctgaccgatggcgacccgtcccggctggccatcagtgatcgcacattgccgcaggtt
accgatgcatccggtaccgagttggtgcttgccactgacccgcgtcgcgcgggccagctg
gtcaacgtcgactcggctgccgccgggcaggtgctggcctccgtggacgtggttttcccg
gtgctgcacggtccttacggcgaggacggcaccattcaggggctgttggagctggcgggg
gtgccgtacgtgggtgccggcgtgctcgcgagcgcggccggtatggacaaggagttcacc
aagaagctgctggccgctgaaggtcttccgatcggcaagtacgccgtgatccggccacgt
gacgcctcactgacccttgatcagcgcgaagagctggggctgccggtcttcgtgaagccc
gcgcgggcgggctcgtcgttcggtgtttcccgggtgaccgcatgggaagagctgcccgcg
gccatcgcacatgcgcgccggttcgacccgaaggtgatcgtggaggccgccatcatcggc
cgcgagttggagtgcggggtgctggagttccccgatggagacatccgggccagcgtgctc
ggagagatccgggtcgaaggggtacgcggccgcgaagacggtttctatgacttcgagacc
aagtacctggacgacaccgccgagctggacgtgccggcgaaggtcgatgacgacgtgagt
gatcagatccgcgagctcgccgtggcggcgttccgggcgatcgactgccaggggctggcc
cgggtcgacttcttcctcaccgaggacggtccgttgatcaacgagatcaacaccatgccc
ggattcaccaccatctctatgtacccccggatgtgggccgcgaccggcgtggactatccg
gcattgctggacgcgatggtccgtaccgcgctggcgcggggcaccgggctgcgctga

DBGET integrated database retrieval system