KEGG   Mycobacteroides immunogenum: BAB75_20900Help
Entry
BAB75_20900       CDS       T04755                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00564  Glycerophospholipid metabolism
miz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAB75_20900
Enzymes [BR:miz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BAB75_20900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA 3HCDH_N NAD_binding_8 HI0933_like AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANO05478
UniProt: A0A0N1CI83
LinkDB All DBs
Position
complement(4210225..4212003)
Genome map
AA seq 592 aa AA seqDB search
MSDATSSSGSSGPTYTFLGPQARALNWERLGSEQFDVIVIGGGVVGAGSALDAATRGLKV
ALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVQEALRERELSLSTLAPHLVKPLPFL
FPLTNRWWERPYIAAGIFLYDQMGGAKSVPAQKHLTRAGALRLAPGLKRNSLIGGIRYYD
TVVDDARHTMTVARTAAHYGAVVRASTQVVSLLREGDRVIGVVVRDTESGAETEVRGHVV
INATGVWTDEIQALSKTRGRFRVTASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGN
HWIIGTTDTEWNLDLAHPAATKVDIDYILDHVNTVLATPLTHNDIDGVYAGLRPLLAGEN
DDTSKLSREHAVAVAAPGLVAIAGGKYTTYRVMASDAVDMASEFVPARVAPSITEKVPLL
GADGYFALINQTEHVGETYGLHPYRVRHLLDRYGSLIGEVLACAGTDHSLLQPITKAPMY
LKVEALYAVAAEGALHLEDILARRMRIAIEYSHRGVDCAQEVAELVAPVLGWSAEDIERE
VDTYRARVDAEVRSQRQPDDASADALRVAAPEARSFIVEPVTETGTVLSPTK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacgcaaccagctcgtcgggatcgagtgggcccacctacacgttccttggaccg
caggcccgtgcactgaactgggaacgcctgggatctgagcagttcgatgtcatcgtcatc
ggtggtggtgtcgtgggcgccgggtcggcgctggacgcggccacccgtgggctcaaggtc
gcgctggtcgaggcccgtgacttcgcgtcgggaacatcaagtcgctcatcgaagatgttc
cacggcggcctgcgctacctggagcagctcgaattcggcttggtccaggaggctctgcgc
gagcgggagctgtctctctccacgctggcgccgcacctggtcaagccgttgccgttcctg
ttcccgctgaccaacagatggtgggagcggccgtacatagcggcgggcatcttcctgtac
gaccaaatgggtggcgcgaaatctgttcccgcccagaagcatctgacccgtgcgggcgcg
ctgcggctggcgccgggtctcaagcgcaattcgctcatcggcggtatccggtactacgac
accgtggtcgatgacgcgcggcacaccatgaccgtggcccgtaccgcggcgcactacggt
gcggtggttcgtgcctccacgcaagtggtctcgctgctacgcgagggagatcgcgtcatc
ggtgtggtggtgcgtgataccgagagcggcgccgaaaccgaagttcgtgggcacgtcgtc
atcaacgccaccggggtgtggaccgatgagatccaggcgctgtccaagacgcgcgggcgt
ttccgggtcaccgcctccaaaggtgtgcacatcgtggtgccacgcgacaggattgtcagc
gaggtcgcgatcatcctgcgcaccgagaagtcggtgctgttcgtgattccgtggggcaat
cattggatcatcggaaccaccgacaccgagtggaatctggatctggcgcaccccgccgcc
accaaggtggatatcgactacatcctggatcacgtgaacactgtgctggcaacaccgttg
acgcacaacgatattgacggagtgtacgcgggattgcgcccgctgctggcgggcgagaac
gatgacacgtccaagctgtctcgcgagcacgcggtcgccgtggcggctccgggcctggtg
gccatcgcgggcggcaagtacaccacgtatcgggtgatggcgtccgacgccgtggatatg
gcaagtgagttcgtgccggcgcgggtggcgccttccatcaccgagaaggtgccgctgctg
ggcgccgacgggtatttcgcgctgatcaatcagaccgagcatgtgggggagacctacggt
ctgcatccgtaccgggtgcggcatctgctggaccggtacggctcgttgatcggtgaggtg
ctcgcctgcgcgggcaccgatcacagcctgctgcaaccgattaccaaggcgccgatgtac
ttgaaggttgaggcgctctatgcggtggcggccgagggtgcgctacatctggaggacatt
ctcgcgcggcgcatgcgtatcgccatcgagtattcgcaccgtggtgtcgactgtgcccag
gaggtcgccgagttggtggcgccggtgctgggctggtcggcggaggacattgagcgcgaa
gtggatacctatcgagcgcgggtcgatgccgaagtgcgttcacagcgccagcccgatgac
gcgtcggcggacgcgctgcgagtggcggcgcccgaggcccggtccttcatcgtcgaaccg
gtgaccgaaaccggcaccgtgctctcgcccaccaagtag

DBGET integrated database retrieval system