KEGG   Mycobacteroides immunogenum: BAB75_21325Help
Entry
BAB75_21325       CDS       T04755                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00250  Alanine, aspartate and glutamate metabolism
miz00410  beta-Alanine metabolism
miz00430  Taurine and hypotaurine metabolism
miz00650  Butanoate metabolism
miz01100  Metabolic pathways
miz01110  Biosynthesis of secondary metabolites
miz01120  Microbial metabolism in diverse environments
miz02024  Quorum sensing
Module
miz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAB75_21325
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAB75_21325
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAB75_21325
   00430 Taurine and hypotaurine metabolism
    BAB75_21325
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BAB75_21325
Enzymes [BR:miz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BAB75_21325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ANO05548
UniProt: A0A0N0KNA6
LinkDB All DBs
Position
complement(4297370..4298788)
Genome map
AA seq 472 aa AA seqDB search
MSNSRDQFRLSAHAGKINASSFSPAYTGRLSTAPIPALRLPDEPMDPQAAYRFIHDELML
DGSSRLNLATFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIESRCVAMVADLFHADD
LSPEDPSSAVGVSTIGSSEAVMLAGLALKWRWRAKVGDDWKGRTPNLVMGSNVQVVWEKF
CRYFDVEPRYLPMAKDRYVITPEQVLDAVDEDTIGVVGILGTTFTGELEPIAEICAALDK
LAATPGKPDVPVHVDAASGGFVVPFLHPELHWDFRLPRVVSINVSGHKYGLTYPGIGFVV
WRGKEHLPEDLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYAQVMRCLSE
TARWFGDELNKSEHFEVITDGSAIPVVSFRLKGNRPYTEFDISHSLRAFGWQVPAYTMPD
DVTDIAVLRVVVREGFSGDLARALRDDLITVLKGLDELKPNGHFDEVQPFAH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattctcgcgatcagttccgtctctcggcgcacgccggaaagatcaacgcctcc
tcgttcagccccgcctataccggccggctgtccacggcgcccatcccggcgctgcggctg
cccgacgagccgatggatccgcaggctgcctaccggttcatccacgacgagctgatgctc
gacggcagctcccgcttgaacttggcgaccttcgtcacgacgtggatggaccccgaggcc
gaaaagctgatggctgagacgttcgacaagaacatgatcgacaaggacgagtacccggcg
accgccgcgatcgagtcgcggtgtgtggccatggtggccgatttgttccatgccgacgac
ttgtcgcccgaggacccgtcctcggcggtgggcgtgtcaaccatcggatccagcgaagcg
gtcatgctggccggtctggccctcaagtggcgctggcgcgccaaggtgggtgacgactgg
aaggggcgcacccccaacctggtgatgggttccaacgtgcaagtggtgtgggagaagttc
tgccggtatttcgatgtggaaccgcggtatctgccgatggccaaggaccgatacgtcatc
actcccgagcaggtgctcgacgcggtcgatgaggacaccatcggcgtcgtcggaatcctg
ggcaccacgttcaccggtgagctggagccgatcgccgagatttgcgcggcgctggacaaa
ctcgccgccactcccggcaaacccgatgtgccggtgcatgtcgacgccgccagcggcggt
ttcgtggtgcccttcctgcatcccgaactgcactgggacttccggctaccgcgggtggtg
tcgatcaacgtcagcggacacaaatacgggctcacctatcccgggatcggtttcgtggtg
tggcgcggcaaggaacacctcccggaggacctggtgttccgggtcaactacctgggtggc
gacatgccgaccttcaccctgaacttctcgcggccgggtaatcaggtggtggggcagtac
tacaacttcctgcggctgggccgagccgggtatgcccaggtgatgcgctgcctgtcggag
acggctcgctggttcggtgacgagctgaacaagagtgagcatttcgaggtgatcaccgat
ggctcggccatcccggtggtgtcgttccggctgaagggcaatcgcccgtataccgagttc
gacatctcgcattcgttgcgggctttcggctggcaggtaccggcgtacaccatgcccgat
gacgtcaccgatatcgccgtgctgcgcgtggtggtgcgcgagggcttctcgggtgacctg
gccagggcgctgcgcgacgacctcatcactgtgctcaagggactggacgagctgaagccg
aacgggcacttcgacgaggtgcagccgttcgcccattag

DBGET integrated database retrieval system