KEGG   Mycobacteroides immunogenum: BAB75_22300Help
Entry
BAB75_22300       CDS       T04755                                 

Definition
(GenBank) peroxidase
Organism
miz  Mycobacteroides immunogenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-ProteinID: ANO05712
UniProt: A0A0N1CDT8
LinkDB All DBs
Position
4502352..4504160
Genome map
AA seq 602 aa AA seqDB search
MAKKNDAAKSATTLASWLATRIDRSIGWSRLPTAFGIAVLIGLRNALRADNLFDTGRAPG
GSPPPENTDYRNARTVDGTYNNLEHPLMGSVGSRFGRNAPLAQTFPEPPEQLLDPNPRLI
SRRLLTRDEFIPATTLNVLAAAWIQFEVHDWFSHNTVETKPWSVPLDGSDPWPQRPMQIR
RTAPDPCPDASGPPTFVTQDTHWWDGSQVYGGTREVAEALRSGSGGTLRMDGQGLPPADV
EALASTSETAANFWVGLAVLHSLFMREHNAICEHLAACHPEMSDQELYDKARLVNTALMA
KIHTIDWTPAIIGHPTTVFAMHTNWSGILGERLNNLFQRQPHNALLRGIPGSPTSLHNVP
YSLTEEFVAVYRMHPLIPDRFVLRSASDDSVLAEHELPDLAVQYVRARFSETPLENIIYS
FGRAHPGALTLHNFPRHLQRLERPDGSILDLAAIDVLRVRERGVPRYNEFRRMLRLRPVS
SFGELTDDPVVAKELAAIYGDDVERVDLMIGLYAEPKPKGFGFSDTAFRIFVLMASRRLE
SDRFFTSDFRPEIYTPEGLAWVRNNSMRSVLLRHFPSLAAALDGVTNPFAPWTPTWAGRS
TE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaagaatgacgccgccaaatcggccaccacactggcgtcgtggctcgcaaca
cgaatcgatcggtcgatcgggtggtcccggcttcccacggcattcggcatcgcggtactc
atcgggctgcgcaacgcgctgcgagccgacaacctgttcgacacgggacgggcgcctggc
ggatcaccgccgcctgagaacaccgactaccgcaacgcccggaccgtcgacggcacctac
aacaaccttgaacacccactgatgggatcggtcggcagccgcttcgggcgcaacgcaccc
cttgcccagactttccccgagccccccgaacaactcctggacccgaatccgcggctgatc
agtcgcaggctgctgacccgcgacgagttcattccggcgacgacgctgaacgtactggcc
gccgcctggatccagttcgaggtccacgactggttcagccacaacaccgtcgagaccaaa
ccatggtccgtgccgctcgacggcagcgatccgtggccacaacgcccgatgcaaatacgc
cgcaccgcacccgacccgtgccccgacgcgtcaggccccccgacgttcgtcacgcaggac
acccattggtgggacggatcgcaggtctacggcggcactcgcgaggtcgccgaggcactg
cgttccggaagcgggggcacactgcggatggacgggcagggcctgccgcctgccgatgtc
gaggcgctggccagcacatcggagacggccgcgaacttttgggtcggtctggccgtcctg
cattcgctgttcatgcgggaacacaacgcgatctgcgagcatctggctgcctgccatccg
gaaatgtccgatcaggagctgtacgacaaggcccgtctggtcaacaccgcgctcatggcg
aagatccacacgatcgactggactcccgcgataatcgggcaccccaccacggtattcgcg
atgcacaccaactggtccggcattctcggcgagcgcctgaacaacctgtttcagcgtcag
ccgcataacgctctcctacgcggcatacccggctccccgacaagtctgcacaacgtgcca
tattcgctgaccgaagaatttgtcgcggtgtaccggatgcacccgctcattcccgaccgt
ttcgtgctgcggtcggcgtctgacgattccgtgctcgccgagcatgaattgccagatctc
gccgttcaatacgtgcgcgcccgcttcagcgagacaccactggagaacatcatctattcg
ttcggccgcgcccacccgggcgcactgactctgcataacttcccacgccatctacagcgt
ctggagcggccggacgggtccattttggacctcgcagccatcgatgtgcttcgcgtccgt
gagcggggcgtcccccgctacaacgagttccgccggatgctgcggctgcggccggtgtcg
tctttcggcgagctcaccgacgacccggtggtggccaaggagctcgcggcgatatacggc
gacgatgtggagcgggtggatctgatgatcggactgtacgcggagcccaaaccgaaggga
tttggcttcagcgacacagcctttcgaatcttcgtattgatggcgtcccggcggctggaa
agcgacagattcttcacgtccgatttccggcccgagatctacaccccggaaggcctcgca
tgggtgagaaacaactcgatgcgttcggtgctgctccggcacttcccgtccctggccgcc
gccctggacggcgtcacgaatcctttcgcaccgtggacaccgacatgggccggcagatcg
accgagtag

DBGET integrated database retrieval system