KEGG   Mycobacteroides immunogenum: BAB75_24590Help
Entry
BAB75_24590       CDS       T04755                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00220  Arginine biosynthesis
miz00250  Alanine, aspartate and glutamate metabolism
miz00290  Valine, leucine and isoleucine biosynthesis
miz01100  Metabolic pathways
miz01110  Biosynthesis of secondary metabolites
miz01130  Biosynthesis of antibiotics
miz01210  2-Oxocarboxylic acid metabolism
miz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAB75_24590
   00290 Valine, leucine and isoleucine biosynthesis
    BAB75_24590
   00220 Arginine biosynthesis
    BAB75_24590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:miz01007]
    BAB75_24590
Enzymes [BR:miz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BAB75_24590
    2.6.1.66  valine---pyruvate transaminase
     BAB75_24590
Amino acid related enzymes [BR:miz01007]
 Aminotransferase (transaminase)
  Class I
   BAB75_24590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANO06082
UniProt: A0A0N1CEU5
LinkDB All DBs
Position
4969680..4970990
Genome map
AA seq 436 aa AA seqDB search
MDSNATIETVSTDNLPTDVPPRVPGLSPRQHQRVFAQSTKLQDVLYEIRGPVHAQAARLE
AEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGILPARRAVVTRYELVD
GFPYLDVDDVYLGNGVSELITMTTQALLDNGDQVLIPAPDYPLWTAATSLAGGTAVHYLC
DETNGWMPDIEDLESKITERTKALVIINPNNPTGAVYSREILTKMVELARKHQLLLLADE
IYDKILYDDAEHISVASLAPDLLCFTFNGLSKAYRVAGYRSAWLAITGPKDHAASLLEGV
NLLANMRLCPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKP
RGALYAFPRLDPEVHQIHDDDQLVLDLLLNEKILLTQGTGFNWPEPDHLRIVTLPWARDL
AVAIERLGNFLASYRQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ctggacagcaatgccaccattgagaccgtgagtaccgataacttgccgactgacgtgccc
ccgcgcgtgcccggtctttcgccgcggcagcatcaacgggtctttgcgcagtccaccaag
ctgcaagacgtcctgtacgagatcaggggtccggtacacgcacaggccgcccggcttgag
gccgaggggcaccgcatcctcaagctcaacatcggcaacccggcacccttcggtttcgag
gcacccgatgtcatcatgcgcgacatcatccaggcgctcccctacgcgcagggctactcc
gactccaagggcatcctgccggcgcggcgcgcggtggtcacccgctacgagctggtcgac
gggttcccctacctggacgtggatgacgtctacctgggtaacggggtgtccgagctcatc
accatgaccacgcaggcgctgctggataacggcgaccaggtgctcatcccggcgcccgac
tatccgctgtggacagccgcgacctcgctggccggcggcaccgccgtgcattacctgtgc
gacgagaccaacggctggatgccggatatcgaggatctggaatccaagatcaccgagcgc
accaaggccctggtcatcatcaacccgaacaacccgaccggtgcggtatacagccgcgaa
atcctcacgaagatggtcgaattggcgcgcaagcatcagctgctgctgctggccgacgag
atctacgacaagatcctctatgacgatgccgagcacatcagcgtcgcgtcactggccccg
gatctgttgtgtttcaccttcaatggcctgtccaaggcataccgagtagccggctaccgt
tcggcgtggcttgccatcaccggccccaaggatcacgcggccagcctgcttgaaggcgta
aacctgttggccaatatgcgactgtgcccgaatgttccggcccagcatgcgattcaggtg
gcgctcggcggccaccagagcatcgacgacctggtgcttcctggtgggcgactgctggag
cagcgcgacgtggcgtggaccaagctcaacgagattcccggtgtctcctgcgtcaagccg
cggggcgcgctctacgcgttcccacgcctggacccggaggtgcaccagatccacgatgac
gatcagcttgtgctggatctgctgctcaatgagaagatcctgctcacgcagggcaccggc
ttcaattggcctgagcccgaccatcttcggatcgtcacgctgccgtgggcgcgtgatctg
gccgtcgccatcgagcggctgggcaacttcctggcgagctaccgccagtaa

DBGET integrated database retrieval system