KEGG   Mycobacteroides immunogenum: BAB75_25085Help
Entry
BAB75_25085       CDS       T04755                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00250  Alanine, aspartate and glutamate metabolism
miz00410  beta-Alanine metabolism
miz00640  Propanoate metabolism
miz00650  Butanoate metabolism
miz01100  Metabolic pathways
miz01120  Microbial metabolism in diverse environments
Module
miz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BAB75_25085
   00650 Butanoate metabolism
    BAB75_25085
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAB75_25085
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAB75_25085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:miz01007]
    BAB75_25085
Enzymes [BR:miz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BAB75_25085
Amino acid related enzymes [BR:miz01007]
 Aminotransferase (transaminase)
  Class III
   BAB75_25085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANO06160
UniProt: A0A0N1LXR6
LinkDB All DBs
Position
complement(5071908..5073185)
Genome map
AA seq 425 aa AA seqDB search
MPVGLRASGSSATALSPVLKQATPVVAVRGQGCYLYDESNREYLDFTAGIGVVSTGHCHP
RVVEAAQRQVATLIHGQYTTVMHRPLQNLVRRLGEVLPSSLDSLFFANSGSEAIEAAVRL
ARQATGRPNIVVFQGGFHGRTLAAATMTTSGPRFSSGIGPLMAGVYSTPFPTAYRYGWSE
AEATRFALQELDYLFATATAPNQVAAMVIEPVLGEGGYIPANTEFLAGIAERARQHGILL
VLDEVQTGFGRTGEYFGHQHFGVTPDILVMAKGIASGFPISGIAAPAELMGRAWPGSQGG
TYGANAVACAAALATLDVIEEERLVENARVRGHELLDGARKIAADRGIDGDVRGLGLMVG
VEFSQEGRPAPQLAARAQAAAAENGLLLLMCGPHMNVVRMIPPLVVTADQISDALGIWSN
VVAGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcggtcttcgcgcaagcggctcatccgcaaccgcgctatcgcccgtcctcaag
caggccaccccggtggtggcggtgcgaggccagggttgctatctgtacgacgaaagtaac
cgcgaatacctcgatttcaccgcgggaatcggcgtagtgagcaccggtcattgccatccg
cgtgtggtcgaggccgcccaacggcaggtggccaccctcatccatggtcaatacacgacg
gtcatgcaccgtccgctgcaaaatctggtgcggcgcctcggcgaggtattgccatccagc
ctcgattctctgttcttcgccaattccggcagcgaggccatcgaggccgccgtacggctg
gcacgtcaggccaccggacgccccaacattgttgtgttccagggcggatttcacggccgg
acgctggccgccgccaccatgacgacttcggggccgcggttctcgtcgggaatcggtccg
ctgatggccggggtgtacagcaccccgttcccgacggcctatcggtacggctggagtgag
gccgaggcgacccggttcgcgctgcaagagctcgactacctgttcgcgacagccaccgcc
cccaatcaggtggcggcgatggtcatcgagccggtgctcggagagggcggatacattccc
gccaacaccgagttcctcgccggtatcgccgagcgtgcgcgtcagcacggcatcctgttg
gtgctcgacgaggtgcagaccgggttcgggcgcaccggcgagtatttcgggcaccagcat
ttcggtgtcaccccagacattctggtgatggccaagggaatcgcgagtggtttccccatc
tcgggcatcgccgccccggccgagctgatgggccgtgcctggcccgggtctcagggcggc
acttacggcgccaatgccgtcgcatgtgcggccgccctggcgaccctggatgtcatcgag
gaggaacggctcgtcgagaacgcccgggtgcgtggccacgaacttctcgatggcgcgcga
aagattgccgccgacaggggaatcgacggtgatgtgcgcgggctcggactgatggtcggt
gtggagttcagccaggagggccggcccgcgccgcaactggcggcacgggcgcaggcggcg
gctgccgagaacggtctgctgctactcatgtgcggaccacacatgaatgtggtgcggatg
attccgccgctggtggtgacggccgatcagatatccgatgctctcggcatctggagcaat
gtggtggcggggctgtga

DBGET integrated database retrieval system