KEGG   Mycobacteroides immunogenum: BAB75_25170Help
Entry
BAB75_25170       CDS       T04755                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
miz  Mycobacteroides immunogenum
Brite
KEGG Orthology (KO) [BR:miz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:miz01001]
    BAB75_25170
Enzymes [BR:miz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BAB75_25170
Protein kinases [BR:miz01001]
 Serine/threonine kinases: Other
  Bacterial family
   BAB75_25170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like APH Kdo PRIMA1
Motif
Other DBs
NCBI-ProteinID: ANO06176
UniProt: A0A0N0KNX8
LinkDB All DBs
Position
5085521..5087299
Genome map
AA seq 592 aa AA seqDB search
MTSSERPPPDAGSQQAGDLAPGTTVSGYQIERVLGRGGMGTVYLAANPNLQRSEALKILS
AQASRDPAFRARFMREASLAASLDHPNIVTVHNRGETPQGDLWIAMQYVQGSDAHSESVN
GRVSLTRAVHIVSEVAKALDYLHARGLVHRDVKPANILLSEGDRRIMLGDFGVARALDDS
SSVTSAGNVTATIAYAAPEVLSGAAVDGRADVYALGCTLFRMVTGQPPFGSGNSLPALIN
AHLSTPPPRISQFAPVPESMDGLIAKAMAKNPADRYQSAGEFASAAQQILADPAQHRQTV
AQPVPAPAPPPAPAPHLVQTTTSPVTADTERTMVRHKRIVAIVGAIVLVVASSVVAVLIW
PRQHNGTHTRPESAPSAANVRPGESLAGQPNAVLDSLLPGQFDYPEGWEKNPSPTFKSGE
FNPAVPPGSATNIGGTPVGCNTIDPIWALRPKGRETSTLYLRDRKNPEREILIRVVPAAD
ALSADGGSDTLKRCDAIAYIIPGGTTTWRCSFEFDEPNPVQNSQKELTTTESCFMFPSGA
NGIRQHVSFNIVRGLLVYILASGASNRNDAAGSLNATTLSFATTMKILRYGR
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatcggagagacccccaccagatgcgggtagccagcaggccggggacctagca
ccggggacgaccgtatccggataccagattgaacgcgtcctcggccgcggcggcatgggt
accgtctatctggccgcgaatccgaatctgcaacgttccgaggccctgaagatcctcagc
gcccaagcctcgcgcgaccccgccttccgggcgcggttcatgcgggaagcatcgctcgcc
gcatccctggaccacccgaacatcgtcacagtgcacaaccgcggcgagactccacagggt
gatctctggatcgcgatgcagtacgtgcagggcagcgatgcgcattcggaatcggtgaac
gggcgtgtgtcgttgacccgggccgttcacatcgttagcgaagtcgccaaggcgctcgac
tatctgcacgcccgcggtctggtgcaccgcgacgtgaagccggccaacatcctgctatcc
gagggtgaccgacgaatcatgctgggcgacttcggcgttgcccgcgcacttgatgacagc
agcagcgtcacctcggcaggtaatgtgacggccactatcgcgtatgccgcaccggaggtc
ctgtccggcgcggccgtcgatggccgagccgacgtgtatgccttgggctgcacgctcttt
cgcatggtcaccggtcaaccgccattcggatccggcaactccctgcccgccctcatcaat
gcgcacctttcgacgcccccgccccggatctcccagttcgcgccggtacccgagtcaatg
gacgggctgattgccaaggcaatggccaagaatcccgctgaccgttaccagagcgccggc
gagttcgcgtcggccgctcagcagatcctggcagatccggcgcagcaccgccagacggtg
gcacagcccgtacccgccccggcacctccgccagccccggcaccacatcttgtgcagacc
accacatccccagtcacagccgacactgagcgaaccatggtcagacacaagcgaattgtt
gccatcgtcggcgccattgtgctggttgtcgcatcctctgtcgtggcggtcctgatctgg
ccgcgccagcacaatggcactcatactcggccggaatccgcgcccagcgcggccaacgta
aggcccggtgaatcgttggccgggcaacccaatgccgtcctcgacagcttgctacccgga
cagttcgactatcccgaggggtgggagaagaatccgtcaccgaccttcaaatcgggcgag
ttcaatcctgccgttccgcccggatcggccaccaacatcgggggaaccccggtgggctgc
aacactattgatcccatctgggcactccgcccgaagggtcgcgagacatccacgctgtac
ctacgggatcggaagaaccccgagcgcgaaatcctgatccgggtggttccggcggcagac
gcgttgtcggccgacggcggctcagacacgctgaagagatgcgatgcgatcgcgtacatc
attcccggcggcaccaccacctggcgatgctccttcgaattcgacgagccaaatcctgtt
cagaacagccaaaaagagctcaccacaacggaatcatgctttatgttcccctcgggagcc
aacggcattcggcaacacgtgtctttcaacatcgtgcgcggactacttgtgtacatcctg
gccagcggcgcctccaaccggaacgacgcggcagggtccctcaacgccaccacgctgagc
ttcgcgaccaccatgaagatcctgcgttacggccgctaa

DBGET integrated database retrieval system