KEGG   Mycobacteroides immunogenum: BAB75_25370Help
Entry
BAB75_25370       CDS       T04755                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
miz  Mycobacteroides immunogenum
Pathway
miz00010  Glycolysis / Gluconeogenesis
miz00053  Ascorbate and aldarate metabolism
miz00071  Fatty acid degradation
miz00280  Valine, leucine and isoleucine degradation
miz00310  Lysine degradation
miz00330  Arginine and proline metabolism
miz00340  Histidine metabolism
miz00380  Tryptophan metabolism
miz00410  beta-Alanine metabolism
miz00561  Glycerolipid metabolism
miz00620  Pyruvate metabolism
miz00625  Chloroalkane and chloroalkene degradation
miz00903  Limonene and pinene degradation
miz01100  Metabolic pathways
miz01110  Biosynthesis of secondary metabolites
miz01120  Microbial metabolism in diverse environments
miz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:miz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAB75_25370
   00053 Ascorbate and aldarate metabolism
    BAB75_25370
   00620 Pyruvate metabolism
    BAB75_25370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAB75_25370
   00561 Glycerolipid metabolism
    BAB75_25370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAB75_25370
   00310 Lysine degradation
    BAB75_25370
   00330 Arginine and proline metabolism
    BAB75_25370
   00340 Histidine metabolism
    BAB75_25370
   00380 Tryptophan metabolism
    BAB75_25370
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAB75_25370
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BAB75_25370
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAB75_25370
Enzymes [BR:miz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BAB75_25370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ANO06213
UniProt: A0A0N1CGS5
LinkDB All DBs
Position
5133933..5135390
Genome map
AA seq 485 aa AA seqDB search
MTDYDKLFIGGVWTEPATDQVIEVISPATGQKVGQCPLASPADVEAAVSAARLAFDDGPW
PKLTPHERQAVLQKAVAGLEARKDEICQAIADETGAPPMVIETLQWMGGFGAIQYYANAA
DAVQWKELRNGAYGQTLVTREPAGVVAAIAAWNVPLFLALNKIGPAFLAGCTVVLKPAAE
TPLSSFILADVFAEAGVPEGVLSVVPGGAETGRALTNNPGVDVFSFTGSTAVGKEIAGIA
AKNLKKVTLELGGKSAAIVLEDADLAAALPMLVFSGLMNAGQGCVNQTRVLAPRSRYDEV
VDGIVGMVSLMGVGLPDDPATQVGPLITEKQRTRVEGYIAKGIEEGARLAFGGKRPEGLE
GGYFVQPTIFADVDNSMTIAQEEIFGPVLSIIAYDSVDEAVKIANDSHYGLAGSVWTTDV
QKGLEVAAQIRTGTYGINWYAFDPSCPFGGYKQSGIGRENGPEGIEEYCELKSVLLPMGY
TLESI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacgacaagctattcatcggtggcgtctggaccgaaccggccaccgaccag
gtgatcgaggtcatctcgccggccaccggacagaaggtgggccaatgtccgctggcctct
ccggctgacgtcgaggcggcagtgagcgcggcccgcctggccttcgacgacggaccgtgg
cccaagctgaccccgcatgagcggcaggcggtgctgcagaaggccgtcgccggcctagaa
gcccgcaaggacgagatatgccaggccattgctgacgaaaccggcgctcctcccatggtt
atcgagacgctgcagtggatgggtggcttcggcgccattcagtactacgccaacgccgcg
gatgcggtgcagtggaaggagctacgcaacggcgcgtacggccagacactggtgacccgc
gagcctgccggtgtggtggcggcgatcgcggcctggaatgtgccgttgttcttggcactc
aacaagatcggccccgcgttcctggccggctgcaccgtcgtgctcaaacccgccgccgag
accccactgtcgagtttcatcctggccgacgtgttcgccgaggccggcgtgcccgagggc
gtgctgtcggtggtgcccggtggcgctgaaaccggccgggcactgaccaacaaccccggc
gtcgacgtgttcagcttcaccggcagcaccgccgtcggtaaagagatcgccgggatagca
gccaagaacctgaaaaaggtcaccttggagctgggcggtaagtccgcggccatcgtgctg
gaagacgcggatttggctgcggcgctgccaatgctggtgttctcgggactgatgaacgcc
gggcagggctgcgtcaaccagacccgggtactggcgccgcggtcacggtacgacgaggtg
gtcgacggcatcgtcggcatggtctcgctgatgggcgtcgggctgcccgacgatccggcc
acccaggtcggtccgctgatcaccgaaaagcagcgcacccgggtcgagggctacatcgcc
aagggcatcgaggagggcgcccgactggccttcggcggcaagcgccccgagggcctcgag
ggcggatacttcgtgcagccaacgattttcgccgacgtcgacaactcgatgactatcgcg
caggaggagatcttcggcccggtcctctcgatcatcgcctacgactcggtggacgaggcc
gtcaagatcgccaacgactcccactacggcctggccggcagcgtgtggaccaccgatgta
cagaagggcctggaggtagcggcacagatccgcaccggcacctacggcatcaactggtac
gcctttgaccccagttgcccgttcggcggttacaagcagtcgggcatcggacgtgagaac
gggcccgagggcatcgaggagtactgcgagctcaagagcgtactgctgcccatgggttac
accctcgagagcatctag

DBGET integrated database retrieval system