KEGG   Methanocaldococcus jannaschii: MJ_0267Help
Entry
MJ_0267           CDS       T00003                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, subunit alpha (porA)
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00010  Glycolysis / Gluconeogenesis
mja00020  Citrate cycle (TCA cycle)
mja00620  Pyruvate metabolism
mja00633  Nitrotoluene degradation
mja00640  Propanoate metabolism
mja00650  Butanoate metabolism
mja00680  Methane metabolism
mja00720  Carbon fixation pathways in prokaryotes
mja01100  Metabolic pathways
mja01110  Biosynthesis of secondary metabolites
mja01120  Microbial metabolism in diverse environments
mja01130  Biosynthesis of antibiotics
mja01200  Carbon metabolism
Module
mja_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mja_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MJ_0267
   00020 Citrate cycle (TCA cycle)
    MJ_0267
   00620 Pyruvate metabolism
    MJ_0267
   00640 Propanoate metabolism
    MJ_0267
   00650 Butanoate metabolism
    MJ_0267
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MJ_0267
   00680 Methane metabolism
    MJ_0267
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MJ_0267
Enzymes [BR:mja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MJ_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DUF2524 MannoseP_isomer DDE_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: AAB98254
UniProt: Q57715
LinkDB All DBs
Position
complement(253892..255061)
Genome map
AA seq 389 aa AA seqDB search
METMCEVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLAEFVANGELDAEYIKVE
SEHSAMSACIGAAATGARTFTATASQGLALMHEMLFIASGMRLPIVMMVANRALSAPINI
WNDHQDSIAERDSGWIQIYVEDNQETLDSIIQAYKIAENEDVLLPVMVCLDGFILTHTVE
PVTIPKAERVREFLGVYEPKHAYLDPDRPITQGPVGVPDCYMETRKQIEEAMERAKKVIR
DVNEEFAEWFKRKYGNGLVEAYNLDNADTVLVAMGSVCGTIKYVIDELKKEGKNVGLLRI
RAFRPFPKEDVKELLKDANNIAVLDKNISLGFNKGALGIEMASILKNKKVCNYIVGLGGR
DIKIDDIKTIINHVEKAEDDSTLWVGLKE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggaaactatgtgtgaagtcaaggttattacaggaacttcagctgctgctgaagcggct
aaattagctgatgttgatgttatagctgcctatccaattacaccacaaacaacgtgtgtt
gagaagttagctgagtttgtagctaatggagagttagatgctgaatatataaaggttgag
agtgagcactcagcaatgtctgcttgcataggggcagctgcaacaggagcaaggacattt
actgcaactgcttcacaaggtttagctttgatgcatgaaatgttattcattgcatcaggt
atgagattgccaatagttatgatggttgctaacagagctttatcagctcctataaacatc
tggaatgaccaccaagattcaatagcagagagagacagtggatggattcagatatatgtt
gaagataaccaagaaacacttgacagcattattcaagcttataagatagctgaaaatgaa
gacgtcttattgccagtcatggtttgtttagatggatttatcttaactcacacagtagag
ccagtaacaattccaaaggcagagagagttagagaatttttaggagtttatgaaccaaaa
cacgcatatttagacccagacagaccaataactcaagggccagtaggagttccagattgc
tacatggagacaaggaaacagatagaggaggctatggagagggctaagaaagttattagg
gatgttaatgaggaatttgctgaatggtttaagagaaagtatggaaatggtttagtcgag
gcttataacttagataacgcagataccgttttagttgcaatgggttctgtttgtgggaca
ataaagtatgttattgatgaacttaaaaaagaaggcaaaaatgttggattgttaagaata
agagcctttagaccattcccaaaagaggatgttaaggagcttttaaaagatgccaataat
atagctgtgttagataaaaacatctcattaggatttaataaaggagctttaggtattgaa
atggcatcaattttaaagaataagaaagtttgcaactacattgttggtttagggggaaga
gacatcaaaatagatgatataaagacaataattaaccatgttgaaaaggcagaggatgac
tctacattatgggttggattaaaggaataa

DBGET integrated database retrieval system