KEGG   Methanocaldococcus jannaschii: MJ_0600Help
Entry
MJ_0600           CDS       T00003                                 

Definition
(GenBank) restriction enzyme, type II R/M system 2
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
mja  Methanocaldococcus jannaschii
Brite
KEGG Orthology (KO) [BR:mja00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:mja02048]
    MJ_0600
Enzymes [BR:mja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     MJ_0600
Prokaryotic defense system [BR:mja02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    MJ_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII
Motif
Other DBs
NCBI-ProteinID: AAB98591
UniProt: Q58017
LinkDB All DBs
Position
531176..532048
Genome map
AA seq 290 aa AA seqDB search
MNFEYIINSLLETIKTYNFFVDWEKIENNIKKIEKRLHILNYLIGKENFKEEFFELLKEY
PEVITVFPILIAVRDNKITILNENMELETLEFKEKKYLTDEEIERYYKFFKETGLEDLLK
NRKIKNLVDYVFGVEVGMDTNARKNRIGDLMENIVKKYIENLCKQNKNLDYIFQATKDKI
KQKWGINLTLDKTNRKFDFAVFNKNTKKLYLIEVNFYSGGGSKLKATAGEYRSLNEFIKN
NNNNVQFIWITDGKGWNTAKNPLKESFNSGVVILNLKMVKEGLLKEILTQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaatacatcattaacagcctcttagaaaccataaaaacctacaatttcttt
gtagattgggaaaaaattgaaaataatataaaaaagatagagaaaagattacatatccta
aattatctaattggaaaagagaattttaaagaggagttttttgaattactaaaagagtat
ccagaggttattactgtttttccaattttaatagctgttagagataacaaaataacaatt
ttaaacgaaaatatggaattagaaaccttagaatttaaagaaaagaaatatttaactgat
gaagaaattgaaagatattataaattttttaaagagactggattggaggatttgttaaaa
aatagaaaaataaagaatttagtggattatgtttttggtgttgaggtaggaatggacacc
aatgcaaggaaaaatagaattggagatttaatggaaaatattgttaaaaaatatattgaa
aatctatgcaaacaaaataaaaaccttgattatatcttccaagcaacaaaagataaaata
aaacaaaaatggggaataaatttaacattggataaaacaaatagaaaatttgattttgca
gtttttaataaaaacactaaaaagttatatctcattgaagttaatttttatagtggagga
ggttcaaagttaaaagctactgctggagagtatagatcattaaatgaatttataaaaaac
aataacaataatgttcaatttatatggataactgatggaaagggatggaatacagcaaag
aatccattaaaagaaagttttaatagtggagttgttatattaaacttaaaaatggttaaa
gaaggattattaaaagaaatattaactcagtaa

DBGET integrated database retrieval system