KEGG   Methanocaldococcus jannaschii: MJ_1235Help
Entry
MJ_1235           CDS       T00003                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, large subunit (rbcL)
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00630  Glyoxylate and dicarboxylate metabolism
mja01100  Metabolic pathways
mja01120  Microbial metabolism in diverse environments
mja01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MJ_1235
Enzymes [BR:mja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MJ_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AAB99239
UniProt: Q58632
LinkDB All DBs
Position
complement(1178682..1179959)
Genome map
AA seq 425 aa AA seqDB search
MDYINLNYRPNEGDLLSCMVIKGENLEKLANEIAGESSIGTWTKVQTMKSDIYEKLRPKV
YEIKEIGEENGYKVGLIKIAYPLYDFEINNMPGVLAGIAGNIFGMKIAKGLRILDFRFPA
EFVKAYKGPRFGIEGVRETLKIKERPLLGTIVKPKVGLKTEEHAKVAYEAWVGGVDLVKD
DENLTSQEFNKFEDRIYKTLEMRDKAEEETGERKAYMPNITAPYREMIRRAEIAEDAGSE
YVMIDVVVCGFSAVQSFREEDFKFIIHAHRAMHAAMTRSRDFGISMLALAKIYRLLGVDQ
LHIGTVVGKMEGGEKEVKAIRDEIVYDKVEADNENKFFNQDWFDIKPVFPVSSGGVHPRL
VPKIVEILGRDLIIQAGGGVHGHPDGTRAGAKAMRAAIEAIIEGKSLEEKAEEVAELKKA
LEYWK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggactacataaacttaaactacagaccaaatgaaggtgatttgttatcttgtatggta
attaaaggagaaaatttagaaaagttggcaaatgagattgctggggagagctctattgga
acatggactaaagttcaaacaatgaaaagcgatatttatgaaaaattaagaccaaaggtt
tatgaaattaaagagattggagaagaaaatgggtataaagttggactaataaaaattgcc
tatccattgtatgattttgaaataaacaacatgccaggagttttagcagggattgcagga
aatatatttggaatgaagatagccaaaggtttaaggatattggactttagatttccagcg
gagtttgttaaagcttataaagggccaagatttggaattgaaggagttagagaaactcta
aaaatcaaagaaagacctttactggggactatagttaaaccaaaagttggtttaaaaact
gaagagcatgcaaaagttgcctatgaagcatgggttggaggggttgatttagttaaggat
gatgaaaatttaacttcccaagaattcaataaatttgaggatagaatttataaaacctta
gagatgagagataaagcagaagaagagactggagaaagaaaagcatatatgccaaatata
acagctccatacagagagatgattagaagggcagagattgctgaagatgctggaagtgaa
tatgtgatgatagatgttgttgtttgtggattctctgcagtgcaatcatttagagaagag
gactttaaatttataatccatgcccacagagctatgcatgcagcaatgacaagaagtaga
gattttggaatatccatgttggcattagctaagatttataggttgttaggagttgaccaa
ttacatataggaacagttgttggaaagatggaaggaggagaaaaagaggttaaagcaatt
agagatgagattgtttatgataaagttgaagcagacaacgaaaacaaatttttcaatcaa
gattggtttgatattaaaccagtatttccagtatcttctggcggagttcatccaagatta
gtcccaaaaatagttgagattttaggcagagatttaattattcaggcaggaggaggagtt
catggacatccagatgggacaagagctggagctaaggcaatgagggctgctattgaggca
attatagaaggaaaatcattagaagaaaaagcagaagaagttgcagagctaaaaaaggct
ttagagtattggaaataa

DBGET integrated database retrieval system