KEGG   Methanocaldococcus jannaschii: MJ_1611Help
Entry
MJ_1611           CDS       T00003                                 

Definition
(GenBank) alpha-amylase (amyA)
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mja  Methanocaldococcus jannaschii
Pathway
mja00500  Starch and sucrose metabolism
mja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MJ_1611
Enzymes [BR:mja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MJ_1611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 CaMKII_AD MarR DUF2733
Motif
Other DBs
NCBI-ProteinID: AAB99631
UniProt: Q59006
LinkDB All DBs
Position
1586389..1587792
Genome map
AA seq 467 aa AA seqDB search
MLITFNFEVHQPHRLNKEINQNGNTLWEKYVDTKLNKEVFNKVANKCYIPTNELILELID
EYDFKVNYSITGVFVEQALEFNDYVLDLFKDLVKTGNVELIAETYHHSLTSLFETEDEFI
EDIEMHRKMYKEIFGFKAKVFRNTELIYNNRIAKIAKDLGFKAIFTEGIEKILGWRSPNY
LYQSPDGMKILLRNYRLSDDIGFRFSARDWDQYPLTADKYAIWLASTPGEVINIYMDYET
FGEHHWKETGIFEFLRYLPIEIAKHEHLEVVNVSEVVDRLEPRGEIYVHEFATISWADTE
RDVSAWLGNKMQRISFEKLKDIGKFIKENSNKLKKLNKFDEIYKMYKVLQTSDNLYYQSI
KGLSDMSVHNYFSHFDTPFDAYASYLNILYDFEYYIKELLAKSEFDKNNRRKDGQKQYEK
DDEVKKESLINTNIIVAKDDKTESIYIEDEEGKKNKRYERDEGFIIA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttaataacgtttaattttgaggtgcatcaaccacataggctaaataaggagataaac
caaaacggaaatactttatgggaaaagtatgtagatacaaaattaaataaagaagttttt
aataaagtggctaataaatgctacattcctacaaatgagttgatattggagcttattgat
gaatatgattttaaagttaattattcaattactggggtttttgtagagcaagctttggaa
tttaatgattacgtgttggatttatttaaggatttggtaaaaactggcaatgttgagttg
atagctgaaacatatcatcactcactaacaagtctatttgaaactgaagatgagtttatt
gaagatattgagatgcatagaaagatgtacaaagaaatatttggttttaaagccaaggtg
tttagaaatactgagctaatatacaacaacagaattgcaaagatagcaaaagatttaggg
tttaaagcgatatttactgagggaattgagaaaatcttaggctggaggtctccaaactat
ctttaccaatcaccagatggtatgaaaattctgttaaggaattataggttgagtgatgac
attggctttagattttcagcaagagattgggaccaatatccattaacagctgataaatat
gctatttggttagcttcaactcctggggaagttataaacatatatatggactatgagaca
tttggagaacatcactggaaagaaactggaatatttgagtttttgagatatttgcctata
gagatagctaagcatgaacatttagaggttgttaatgtcagtgaggttgttgatagatta
gagccaagaggagagatttacgtgcatgaatttgccacgatatcatgggctgacactgag
agggatgtaagtgcatggttagggaataagatgcaaagaatatcgtttgaaaaactaaaa
gatattggtaaatttataaaagagaactcaaacaaattaaaaaaacttaataaatttgat
gaaatatataagatgtataaggtcttacagacaagcgataatctttattatcaatccatt
aaggggcttagtgatatgagtgttcataactatttcagccattttgacactccatttgat
gcctatgcaagttatttaaacattttatatgattttgaatattatataaaagaattgtta
gctaaatcggaatttgataaaaataatagacggaaagatggacaaaagcaatatgaaaag
gatgatgaagtaaaaaaggaaagtttaataaatacaaatattatagttgcaaaagatgat
aaaacagaaagtatttatattgaggatgaagagggtaaaaagaataaaagatatgaaaga
gatgaaggatttataattgcatga

DBGET integrated database retrieval system