KEGG   Mycolicibacter sinensis: JDM601_0329Help
Entry
JDM601_0329       CDS       T01512                                 

Gene name
aspC
Definition
(GenBank) aspartate aminotransferase AspC
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00220  Arginine biosynthesis
mjd00250  Alanine, aspartate and glutamate metabolism
mjd00290  Valine, leucine and isoleucine biosynthesis
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01130  Biosynthesis of antibiotics
mjd01210  2-Oxocarboxylic acid metabolism
mjd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JDM601_0329 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    JDM601_0329 (aspC)
   00220 Arginine biosynthesis
    JDM601_0329 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mjd01007]
    JDM601_0329 (aspC)
Enzymes [BR:mjd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     JDM601_0329 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     JDM601_0329 (aspC)
Amino acid related enzymes [BR:mjd01007]
 Aminotransferase (transaminase)
  Class I
   JDM601_0329 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Alliinase_C Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEF34329
UniProt: F5YZQ3
LinkDB All DBs
Position
complement(344803..346080)
Genome map
AA seq 425 aa AA seqDB search
MTAHQLPHQMPWPAIGSQLRQRTFAQSTKLQDVLYEIRGPIHAQAARMEAEGHRILKLNI
GNPAPFGFEAPDVIMRDMIQALPHAQGYSDSQGILPARRAVVTRYELVEGFPRFDVDDVY
LGNGVSELISMVLQALLDNGDQVLIPAPDYPLWTASTSLAGGTPVHYLCDETQGWQPDIA
DMESKITERTKALVVINPNNPTGAVYGREVLSQIAELARKHQLLLLADEIYDKILYDDAE
HTNMAALAPDLLCLTFNGLSKAYRVAGYRAGWVAITGPKEHATSFLEGINLLANMRLCPN
VPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWSKLNEIPGVSCVKPSGALYAFPRLD
PEVYPIQDDEQLVLDLLLQEKILVTQGTGFNWPAPDHLRIVTLPWARDLSGAIERLGNFL
VGYRL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcaccagttgcctcaccagatgccctggcctgccatcggcagccagctgcgg
cagcggacgttcgcgcagtcgaccaaactgcaggacgttctctacgagatccgcggtccg
atccatgcccaggccgcccggatggaggccgaggggcaccgcatcctcaagctcaacatc
ggcaacccggcgccgttcgggttcgaggcgcccgacgtgatcatgcgcgacatgatccag
gcgttgccgcacgcgcagggatattcagattcgcagggcatcctgccagcgcggcgcgcg
gtggtcacccgctacgaactggtcgaggggttcccccgcttcgacgtcgacgacgtctat
ctgggcaacggggtctccgagctgatcagcatggtgcttcaggcactgctggacaacggc
gatcaggtgctgatcccggctccggactatccgctgtggacagcgtcgacgtcgctggcc
ggtggaacgccggtgcactatctgtgcgacgagacccagggctggcaacccgacatcgcc
gacatggaatcgaagatcaccgagcggaccaaggcgctggtggtgatcaacccgaacaac
ccgaccggtgccgtctacgggcgggaggtgctcagccagatcgccgagttggcccgcaag
catcaactcctgctgctggccgacgagatctacgacaagatcctctacgacgacgccgag
cacacgaatatggccgccctggcgccggatctgctgtgcctgaccttcaacgggttgtcg
aaggcctaccgggtggcgggttaccgggccggctgggtggcgatcaccggccccaaggag
cacgcgaccagtttcctggagggcatcaatctgctcgccaacatgcggctgtgcccgaat
gtgccggcgcagcacgctattcaggtggcattgggcggccatcagagcatcgacgatctg
gtactgccgggcggtcgactgctcgaacaacgtgacgtggcctggagcaagctcaatgag
attcccggcgtctcctgcgtcaagccgagtggtgcactctacgcgttcccgcggctcgac
cccgaggtctacccgatccaggacgacgagcagctggtcttggatctgctgctgcaggag
aagatcctggtgactcagggcaccgggttcaactggccagcgccggaccatctgcgcatc
gtgacgctgccgtgggcccgcgatttgtccggcgccatcgaacggctgggcaacttcttg
gtgggctaccggctgtag

DBGET integrated database retrieval system