KEGG   Mycolicibacter sinensis: JDM601_0386Help
Entry
JDM601_0386       CDS       T01512                                 

Gene name
thiO
Definition
(GenBank) thiamine biosynthesis oxidoreductase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00730  Thiamine metabolism
mjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    JDM601_0386 (thiO)
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     JDM601_0386 (thiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 3HCDH_N Pyr_redox NAD_binding_2 AlaDh_PNT_C NAD_binding_8 GIDA FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEF34386
UniProt: F5YZW0
LinkDB All DBs
Position
403625..404635
Genome map
AA seq 336 aa AA seqDB search
MPGPSLGSLAVIGGGVIGLSVAMQAARAGWSVRVHRTADPGASWVAGGMLAPHSEGWPGE
DQQLRLGLRSLELWHDFLVRLPAEVVTARESLVVAADRADVADLRTVADWLTAQGHPVIW
ESAAGEVEPLLAAGIRHGFRAPTELAVDNRAVVTALVTACEELEVAWAGPVHDLAEVAAD
AVVIANGIDAPALWPGLAIRPVKGEVLRLRWRKGCLPVPQRVIRARVHGRQVYLVPRPDG
VVVGATQYEHGRDTAPVVSGVRDLLDDACALVPALGEYELAECGAGLRPMTPDNLPLVRR
LDERTYVAAGHGRNGFLLAPWTAEQVVSELLPVGVQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaccctcgctcgggtcgctggccgtgatcggcggcggtgtcatcggtctgtcg
gtggccatgcaggccgcccgcgccgggtggtcggtgcgggtgcatcgcaccgcggacccg
ggcgcctcctgggtggccggcggaatgttggccccgcacagtgagggctggccgggggag
gaccagcagctgcggctggggctgcgctccctggagttgtggcacgacttcctcgttcgg
ctgccggccgaggtcgtcaccgcgcgcgaatcgctggtggtggccgccgaccgcgccgat
gtcgccgacctgcgcaccgtcgccgactggctgaccgcacagggccacccggtgatctgg
gaatcggccgcgggtgaggttgaaccgctgttggccgccggtatccggcacggcttccgg
gcgcccaccgagctggcggtcgacaatcgcgcggtggtcaccgctttggtcaccgcctgc
gaggaactcgaggtggcgtgggcgggaccggtgcacgatcttgccgaggtggcggccgac
gcggtggtgatcgccaacgggatcgacgccccggcgctgtggcccggcctggcgatccgg
ccggtcaagggcgaggtgctgcggctgcggtggcgcaaaggctgtttgccggtgccgcag
cgggtcattcgggcccgggtgcacggccggcaggtctatctggtgccgcgccccgacggc
gtggtggtgggagccacccagtacgagcacggccgggacaccgccccggtggtctccggg
gtgcgcgacctgctcgacgacgcctgcgcactggtgccggcgctgggggagtacgagctg
gcggaatgcggagccggtctgcggcccatgacaccggacaacctgccgctggtccgccgg
ctcgacgaacggacttacgtcgccgccggccacggccgcaacggttttctgttggcacca
tggaccgccgaacaggttgtgtccgaactacttccggttggagtgcaatga

DBGET integrated database retrieval system