KEGG   Mycolicibacter sinensis: JDM601_0480Help
Entry
JDM601_0480       CDS       T01512                                 

Definition
(GenBank) Beta-ketoacyl synthase
Organism
mjd  Mycolicibacter sinensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 AMP-binding KR Ketoacyl-synt_C PP-binding KAsynt_C_assoc adh_short adh_short_C2 Thiolase_N T2SS-T3SS_pil_N NAD_binding_10 CbiC GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: AEF34480
UniProt: F5Z1H9
LinkDB All DBs
Position
496671..503810
Genome map
AA seq 2379 aa AA seqDB search
MSGPDDTVHTLRTLVDLLMQRAQQRGDAPAFSFSRDGDEHETSRASYRELDRRARQIAAD
LQAQGAAGERVLVLCPPGLDFIAGFFGCLYAGAIAIPVHPPMREHLLPRVESIIVDVQPG
FALTTSEIEPRIKPAIDALPGGQALRWTITDDTAAGSEAAWTPPRIDGDSIAMLQYTSGS
TSAPKGVVLTHGNLVHNLVTIAEAWDANTDMPHVVGVFWLPPYHDMGLIGGLLETLYVGG
HSILMPPTAFIKRPMRWLEAISRHRAMITAAPNFAFDMCVELSSPAERAALDLSNWTVAL
CGAEPVRTATLDAFAEAFAPAGFAKESFYPVYGLAEATLLVSGGSDRPVPMVQHIDRVAL
GDNRVIDVHADDPNVATLVGCGKPRGGQRVIIVDPETRRECAADRVGEIWLAGGSVAHGY
WGASELSAETFAATLSDSGEGPFLRTGDLGFLHSGELFVTGRRKDLIIIRGTNHYPNDIE
LTVQNTNPGLLRGRGAVFSIAPEPGAAEQLVVVQEVDPSRIGADAADEAMQAIRTAVTEN
HSVRTYAVVLVQPLQLPTTSSGKIQRSACKQQYLDGALPVVAQWPSAASQPPPQPESEPA
SAAQPGQQAAGTRTAAEISAWLVDRLAQDLELPVAEVDPAKPFAFYGLDSIHAVRLSTAL
EQWLGCELAPTIAYEYPSIDILSDHLARVAKNEQSGSQPPEPAERPAADEPIAIVGIGCR
FPGADGPEAFWRLLSGGVDATGEVPADRWDVDAFYNPDPSVPGTAVTRRGGFLDQVDQFD
FQFFGISPRESAQMDPQQRLLLEVAWEALEDAGQVPDALAGSRTGVFVGISTNDYGFLRL
GQPQLVDAYTGTGNALSIAANRLSYTFDFHGPSLSVDTACSSSLVAVDLACRSLRDGECS
MALAAGVNVILSPALAINFSKARVMAPDGRCKTFDADADGYVRGEGAGVVVLKPLRKALE
DNDPVYAVIRGSATNSDGRTNGLIAPSGRAQERVVLEAFRRAGLPAGAVQYIEAHGTGTA
IGDAIEANALGTVLAEGRPEGSRCLVGSVKTNIGHLEAAAGIAGLIKVALSLQHRSIPGS
LNYTEPNPHILFDSLPLEVAQTLTPWPAGSRAVAGVSSFGFGGTNAHVVLTEAPQVRSSH
PDDDAAPRAELLALSARSPEALTALVGEYEMALFSGGLAGGGALADLCYTAGARRGHHDY
RLAVVGDSPAALFELLSAYRLGESRPGLTVGHCSPGRPGPGVTFIFSGQGSQWHGMAQRL
QAEEAVFADALAACDNALHPHLGHSILKELARDEDKSKLSDIGILQPTIFAIQVALAALW
RSWGVEPAAVVGHSLGEVAAAHVAGALSLEDAARVICARARMLRGVRGRGAMMVTETTLT
EAQELIAGHEREVAVAASNSHRSTVLAGERAVLEELMAQLAKRDRFCRWIEVDVASHSPQ
MEALGAGLRGSLVKLKPTAPAVPMYSTVTGELVGEQLLDADYWVANLCSPVRFSPALRRL
LETGHDTFVELSPHPILLTAAREDVEDMRRTCSLLPSMRRDDEGRSTMLGALGALYTRGH
PVAWEQIYPRGSHCVPAPTYPWQRVHSWLDAGSIAAPRRGSTAASGGWRGPIRSAAQPGT
VLAELDVTGVTAPSAEQLGELACKAAELAFGPGSRSVGELSLRGGPAAASTLQFALTDDA
FECYASAAGGHWSLLATGTLVAGQAGEPVVVAPADPRDRSYVLRWQPASIVADGSGRSEG
RAAEPGSWLILSDGPVADTLRDHLEAQSQSCVLVEAVVGLAEIERVSADSYRIDPDKPEH
FAELLRAAFGGDRPPCRGVVQLWNLLVSDDESLDTATTLGSLSVIHLIQALTLSGWPESP
RLWLVTRGAQPAGWDEAGPAAPAVGQAPVWGLARSIDHEHPELRATAVDLSTDSGTEELR
GLFSEIWSDNSETDVALRGHRRYVARLEPLENPAALSEQPGEFAARHDASYLITGGLGAV
GGKIAGWLVERGARHLVLMGRSAPSAAAQATLDALRAAGAEVTVAQGDVTKADDVAAALA
TIGATMPPLRGVVHAAGTVDDAILARLDAAKLRAVMAPKVQGAWNLHTLTADAELDFFVL
FSSAASVLGSPGAANYGAANAFLDALAWHRRAGGRPALSVNFGPWAGLGMFTNSELHRHF
SHYGVEGMSAAAYFAALEALLAGPASQATQVLVLDIDWARWRPSAQSPLLRDLQAAVPGG
PDDLATASGLFEAVQAADPAQRQQLLETYLRDLVAGKLGLAPAGLDVTAPLNNLGVDSLI
TLELRIQVERELGIVVPVARLLDGPSVVSLSSWLSGQLAAGGHAEPIPVPGTGAAPDVPL
PTPEADVLAQVSDLSDEAVDALLAKMIAEGEHAQDGSSP
NT seq 7140 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggccggacgacacggtgcacaccctccgcacgctggtggacctgctgatgcag
cgtgcccagcagcggggcgatgccccggcgttcagcttctcccgtgacggcgacgagcac
gagaccagtcgggcgtcctaccgggaactcgaccggcgtgcccgccagatcgccgctgac
ctgcaggctcagggagccgccggggaacgggtgctggtgctgtgcccgcccggcctggat
ttcatcgccggcttcttcggctgcctctacgccggtgccatcgcgatcccggtgcacccc
ccgatgcgcgaacacctcctcccgcgcgtcgagtcgatcatcgtcgacgtccagcccggc
ttcgcgctcaccaccagcgagatcgagccgaggatcaagcccgcgatcgacgcgctgccg
ggcggacaggcgctgcggtggacgatcaccgacgacaccgccgcgggcagcgaggcggct
tggacgccgccgcggatcgacggcgacagcatcgcgatgctgcagtacacctccgggtcg
accagtgcccccaagggcgtggtgctcacccacggcaacctggtgcacaacctggtgacc
atcgccgaggcctgggacgccaacaccgacatgccgcacgtggtcggcgtcttctggctg
ccgccctaccacgacatgggcctgatcggcgggctgctggaaaccctctatgtcgggggc
cattcgatcctgatgccgccgaccgcgttcatcaagcggccgatgcggtggctggaggcg
atctcgcggcatcgcgccatgatcaccgcggcgcccaacttcgccttcgacatgtgcgtc
gagctgagcagcccggccgagcgcgcggcactggacctgtccaattggacggtcgcgctg
tgcggcgccgaaccggtgcgcaccgccaccctggacgcgttcgccgaggcgttcgcaccg
gccggcttcgcgaaggaatcgttctatccggtgtacgggctggcggaggccaccctgctg
gtctccggcggctcggaccgcccggtgccgatggtgcagcacatcgaccgggtcgcgctc
ggcgacaaccgggtcatcgacgtgcacgcggacgaccccaacgtcgcgaccctggtgggt
tgcggcaagccgcgcggcggccagcgggtgatcatcgtcgatccggagacccgccgggaa
tgcgccgccgaccgggtcggggagatctggctggccggcggcagcgtcgcccacggctac
tggggggcttcggagctgtccgcggagacgttcgccgcgaccctgtccgacagcggcgag
ggccccttcctgcgcaccggcgatctgggcttcctgcattccggggagctgttcgtcacc
ggtcgccgcaaggacctgatcatcatccggggtaccaaccactaccccaacgacatcgag
ctgaccgtgcagaacaccaacccggggctgctgcgcggccgcggtgcggtgttctcgatc
gccccggaaccgggcgctgccgaacagctcgtcgtggtgcaggaggtcgacccgagccgg
atcggtgccgacgccgccgacgaggcgatgcaggcgatccgtaccgcggtgaccgagaac
cactccgtccgcacctacgccgtcgtcctggtgcagccgctgcaactgcccaccacctcc
agcggcaagattcagcgcagcgcctgcaagcagcagtacctcgacggcgcgctgccggtc
gtggcgcagtggccgtcggccgcctcgcagccgccgccgcagcccgagtccgaaccggcc
tcggcggcgcagccgggacagcaggccgcgggaactcgcaccgcggccgagatcagcgcc
tggctcgtcgatcggctcgcccaggacctcgagttgcccgtcgccgaagtcgacccggcc
aaaccgttcgccttctacgggctggattccattcacgcggtgcggctttcgaccgccctg
gagcagtggctgggctgtgagctggcccccaccatcgcctacgaatatccctcgatcgac
atcctctcggaccacctggcccgcgtggccaagaacgagcagtccggtagccagccgccc
gaacccgccgaacggccggccgccgacgagccgatcgcgatcgtcggcatcggttgccgg
ttcccgggggccgacgggcccgaggccttctggcggctgttgtcgggcggggtggacgcc
accggtgaggtcccggccgaccgctgggacgtcgacgcgttctacaaccccgatccgtcg
gtgccgggtaccgcggtcacccgccggggcgggttcctggaccaggtcgaccaattcgac
tttcagttcttcgggatctcgccgcgggagtcggcgcagatggacccgcagcagcggctg
ctgctcgaagtggcctgggaggccctggaagatgccggtcaggtcccggacgcgctggcc
ggcagccgcaccggcgtgttcgtcggcatctccaccaacgactacggcttcctgcggctg
ggtcagccccagctcgtcgacgcctacaccggcaccggcaacgcgctgagcatcgccgcc
aaccggttgtcctacaccttcgacttccacggcccgagcctgtcggtcgacaccgcctgc
tcctcgtcgctggtggccgtcgacctggcgtgccgcagcctgcgcgacggcgagtgcagc
atggcgctggcggccggggtgaacgtgatcctgtcgccggcgctggcgatcaacttttcc
aaggcccgggtgatggcccccgacggccggtgcaagaccttcgacgccgacgccgacggg
tatgtgcgcggcgagggcgccggagtggtggtgctcaagccgctgcgcaaggcgctggag
gacaacgacccggtctacgcggtgatccgcggcagcgccaccaactccgacggccggacc
aacggcctgatcgcccccagcggtcgggcgcaggagcgcgtggtcctcgaggcgttccgc
cgggcgggcctgccggccggtgcggtccagtacatcgaggcacacggcaccggcacggcc
atcggcgacgccatcgaggccaacgccctgggcaccgtgctggccgagggccggccggag
ggcagccgctgcctggtgggctcggtcaagaccaacatcggccacctggaggcggccgcc
ggtatcgccgggctgatcaaagtggcgctgtcgctgcagcatcggtccattccgggcagt
ctgaactacaccgagccgaatccgcacatcctgttcgacagcctgcctctggaggtggcg
cagaccctgaccccgtggccggcgggcagccgcgccgtggccggcgtcagctccttcggg
ttcggtggcaccaacgcccacgtggtgctcaccgaggccccgcaggtccgcagcagccac
ccggacgacgatgccgcgccgcgcgccgaactgctggcgctgtccgcccggtcgccggag
gcgctgaccgcgctggtcggcgagtacgagatggctctgttttccggcggtctcgcgggg
ggcggcgcgctggccgacctctgctacaccgccggcgcacgccgcggccaccacgactac
cggctggcggtggtcggcgactcaccggccgcgctgttcgagttgctgtcggcctaccgg
ctcggtgagtcccgtcccgggctgacggtcgggcactgctcgccgggccggcccggtccc
ggcgtgacgttcatcttctcggggcagggctcgcagtggcacggcatggcgcagcggttg
caggccgaggaagcggtgttcgccgacgcgctggccgcctgcgacaacgcgctgcacccg
cacctggggcactcgatcctcaaggagctggcccgcgacgaggacaagtccaagctctcc
gacatcggcattctgcagccgacgatcttcgcgattcaggtggcgctcgccgcgctgtgg
cggtcctggggtgtcgaacccgccgcggtggtcgggcacagcctcggcgaggtggcggcc
gcccacgtcgccggggcgctgagcctcgaggacgcggcgcgggtgatctgcgcgcgggcc
cggatgctgcggggcgtgcgcggccgcggcgcgatgatggtcaccgagaccaccctgacc
gaagcgcaggagctcatcgccggtcatgagcgcgaggtggcggtcgccgccagcaacagc
caccggtcgacggtgctcgccggtgagcgcgcggtgctggaagagctgatggcccaactg
gccaagcgggaccggttctgccggtggatcgaggtcgacgtggcctcccacagcccgcag
atggaggccctcggggcgggcctgcgcggcagcctggtcaagctgaagccgaccgcgccg
gcggtgccgatgtactcgacggtcaccggggaactggtgggcgagcagctgctggacgcc
gactactgggtggccaatctgtgttcgccggtgcggttctcaccggcgctgcgacggctg
ctggagaccggacacgacaccttcgtcgagctcagcccgcacccgatcctgctgacggcg
gcccgtgaagacgttgaagacatgaggcgcacctgcagcctcttgccttcgatgcgccgc
gacgatgagggccgctcgaccatgctcggcgcgctgggagccctctacacccggggacac
ccggtggcctgggagcagatctacccgcggggcagccactgcgttcccgcgcccacctac
ccctggcagcgagtgcactcctggctggatgccggctccatcgccgcgccgcgccgcggc
agcaccgcagcctcgggcggctggcgcggccccatccggtcggccgctcagcccggaacg
gtgctggccgagctggatgtcacgggcgtgacggcgccatcggccgagcagctgggtgaa
ttggcttgcaaggcagctgaactggcgttcggcccgggcagccggtcggtcggtgaactg
agcctgcgcggcggtccggccgccgcgagcaccctgcagttcgcgctgaccgatgacgcg
ttcgagtgttacgccagcgcggccggcggccactggtcgctgctggccaccggcaccctc
gtcgccggccaggccggtgagccggtcgtcgtcgcccccgcggatccgcgcgaccgcagc
tatgtgctgcgctggcagcccgcgtcgatcgtcgccgacggctcaggccggtccgaaggc
cgggcggccgaacccggcagttggctgatcctgtccgacggcccagtggccgacacgctg
cgggaccacctggaggcgcagtcgcagtcctgcgtgctggtggaggcggtcgtcgggctc
gccgagatcgaacgcgtgagcgcggacagctaccgcatcgacccggacaaacccgaacac
ttcgctgagctgctgcgcgcggcgttcggcggcgaccggccgccgtgtcgcggcgtggtg
cagctgtggaacctgctggtctccgacgacgagtcgctggacaccgcgaccaccctcggg
tcgctgagcgtgatccacctcatccaggccctgacgctgtcgggctggccggagtcgccg
cggctgtggctggtgacccgcggtgcgcaaccggccggctgggacgaggccgggcccgcc
gcaccggcggtggggcaggcgccggtctgggggctggcccgcagcatcgaccacgaacat
ccggaactgcgcgccaccgccgtcgacttgtcgaccgacagcggcaccgaagaactgcgc
ggcctgttcagcgagatctggtcggacaacagcgagaccgacgtggcgctgcgcggccac
cgccgctacgtggcgcgactggagcccttggagaacccggcggcgctgtccgaacagccc
ggcgagttcgcggcgcgccacgacgccagctatctgatcaccggcggcctcggcgcggtc
ggcggcaagatcgccggctggctggtcgagcgcggcgcccgccacctggtcctgatgggg
cgcagcgcgccgtcggccgccgctcaggcgaccctggacgcgctgcgggcggcgggcgcc
gaggtgacggtcgcccaaggtgacgtcaccaaggccgatgacgtcgcggcggccctggcc
accatcggtgcgacgatgccgccgctgcgcggcgtggtgcacgcggccggcaccgtcgac
gatgcgatcctggcgcgtctcgatgccgcgaagctgcgcgcggtgatggcgccgaaggtg
cagggcgcctggaacctgcacaccctgaccgccgatgcggaactggacttcttcgtgctg
ttctcctcggccgcgtcggtgctgggttcgcccggggccgccaactacggggccgcgaac
gccttcctcgacgcgctggcctggcaccgtcgggcgggcgggcggccggcgctcagcgtc
aacttcggcccgtgggccggattgggcatgttcaccaactccgagttgcaccgccacttc
tcgcactacggcgtcgagggcatgtcggcagcggcgtacttcgccgcgctggaggcgttg
ctggccggcccggcttcccaagcgacccaggtcttggtgctcgacatcgactgggcgcgg
tggcgtcccagcgcgcagtcaccgctgctgcgcgacctgcaggcggcggtgccgggcggc
ccggacgacctggccaccgcgagcgggctgttcgaggcggtgcaggccgccgatccggcg
caacgtcagcagctgctggagacctatctgcgtgacctggtcgccggcaagctgggactg
gccccggcgggcctggatgtcaccgcgccgctgaacaatctcggggtggattcactgatc
accctggaactgcgcatccaggtggagcgggaactcggcatcgtggtgccggtcgcccgc
ctgctggacggccccagtgtggtcagtctgtccagctggctcagcgggcagttggccgcc
ggcggccacgccgagccgatcccggttcccggcaccggtgcggcacccgacgtcccgctg
ccgacaccggaggctgacgtgctcgcgcaggtctccgacctctccgacgaggcagtggat
gcgttgctggcgaagatgatcgccgagggcgagcacgcccaggatgggagtagcccgtga

DBGET integrated database retrieval system