KEGG   Mycolicibacter sinensis: JDM601_1578Help
Entry
JDM601_1578       CDS       T01512                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00071  Fatty acid degradation
mjd00410  beta-Alanine metabolism
mjd00592  alpha-Linolenic acid metabolism
mjd00640  Propanoate metabolism
mjd01040  Biosynthesis of unsaturated fatty acids
mjd01100  Metabolic pathways
mjd01110  Biosynthesis of secondary metabolites
mjd01200  Carbon metabolism
mjd01212  Fatty acid metabolism
Module
mjd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    JDM601_1578
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JDM601_1578
   00592 alpha-Linolenic acid metabolism
    JDM601_1578
   01040 Biosynthesis of unsaturated fatty acids
    JDM601_1578
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JDM601_1578
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     JDM601_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AEF35578
UniProt: F5YZX4
LinkDB All DBs
Position
complement(1717865..1719814)
Genome map
AA seq 649 aa AA seqDB search
MTISAALCDTLDGRWRAVKNRVRATLSDEKFRPHHTPNTVIARAKVAEQLRIMAGTGVAA
DSFRKEHGGTGDVGAAVSMIEMLAMSDLSLMVKAGVQWGLFGGAVENLGTERHHRAYVQK
IIDLDLLGCFAMTETGHGSDVQALETTATYDPATEEFVIDSATGTARKDYIGGAAETATI
AAVFAQLRTPGPGGEEQGHGVHCLLVPIRDSEGNDLPGVTTSDCHYKGGLPGVDNGRIVF
DHVRVPRENLLNRYADVDPDGSYRSSIESDGRRFFTMIGTLIRGRVSVGGSAGAAARVAL
DIATRYALQRRQFSAPSDDGAEHEVLIMDYLVHQRRLLPLIARSYALQFAQNELVSKCHD
LQTADDPDPEEQRELEARAAGLKAANTWHASRAIQEAREACGGAGYMAENRLIALRADTD
VFTTFEGDNHVLTQLVAKQLLTAYADDIAGMSPVDWVRFAAETVSDRVLKRTAAETIIQT
FVDARQDSEEEGSLFNRGTQLHMFTDREEYLLTSVARRLRAKSEEMSDFDAFNAVQDHVL
HAAAAHIDRVVLEAFVAGIESCPDAAARELLELVCDLYALSVIEDDKAWYIEHRYLSTDR
AKAVTRGINDRCRKLRPHAETLVDGFGIPEQLRYAEMLHPEHLAETARR
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatctccgcagcactctgtgacaccttggatggccgttggcgcgcggtgaagaac
cgggtccgagccaccctgtccgatgagaaattccgtccgcaccacacgccgaacacggtg
atcgcgcgcgccaaggtcgccgaacagctcaggatcatggccggcaccggtgtggccgcc
gacagcttccgcaaggaacacggtggaaccggcgatgtcggcgcggcggtcagcatgatc
gagatgctggcgatgtcggatctgtcgctgatggtcaaggccggcgtgcagtgggggctg
ttcggcggcgccgtggagaacctgggcaccgagcggcaccaccgcgcctacgtccagaag
atcatcgacctcgacctgctgggctgcttcgcgatgaccgagaccggccacggcagcgac
gtacaggcgctggagaccaccgccacctacgacccggcgaccgaggagttcgtcatcgat
tcggccaccggtacggcacgcaaggactacatcggcggggcggccgaaaccgccaccatc
gctgcggttttcgcccagttgagaacaccgggcccgggcggggaagagcaggggcacggc
gtgcactgcctcctggtgccgatcagggattccgaggggaacgacctgcccggcgtcacc
acctcggactgtcattacaagggcggtctgcccggggtggacaacggtcgcatcgtcttc
gatcacgtccgggttccgcgcgagaacctgttgaacaggtacgccgatgtcgaccccgac
ggcagttatcggtcatcgatcgaaagcgacggccggcgattcttcaccatgatcggcacc
ctcatccgcggccgggtttcggtgggcggcagcgcgggcgcggccgcccgggtcgcactg
gacatcgccactcgatacgccttgcagcgcaggcagttcagcgcgccgagcgacgacggc
gccgagcacgaggtgcttatcatggactacctggtacaccagcgccggctgctgccgctg
atcgcacggtcatacgcgctgcagttcgctcagaacgaactggtgagcaaatgccatgac
ctgcagaccgccgacgaccccgaccccgaggaacagcgggagttggaggcgcgggcggcg
gggctgaaggccgccaacacctggcacgcgtcccgggcgatccaggaggcgcgcgaggcc
tgcggcggcgcgggctacatggccgagaaccggctgatcgcgttgcgcgccgacaccgac
gtgttcaccaccttcgagggcgacaaccacgtgctgacccaactggtggccaagcaactg
ttaaccgcctacgccgacgacatcgccggtatgagcccggtcgactgggtgcgtttcgcc
gccgagacggtcagcgaccgggtgctgaaacgtaccgccgcagagacgatcatccagacc
ttcgtcgacgcccggcaagacagcgaggaagaaggcagtctgttcaaccggggtacccag
ctgcacatgttcaccgaccgcgaagagtatctgctgacgtcggtggcgcgccggttgcgg
gccaagtccgaggagatgagcgacttcgacgccttcaacgccgttcaggaccacgtgctg
cacgccgcggccgcccacatcgaccgggtggtgctggaggccttcgtcgccggcatcgaa
tcctgcccggacgcggctgcccgcgagctgctggagctggtgtgcgacctgtacgcgctc
agcgtcatcgaggacgacaaggcgtggtacatcgagcaccgctacctgtccaccgatcgg
gccaaggcggtgacccgcggcatcaacgaccggtgccggaagttgcggccgcacgccgag
accctcgtcgacgggttcggcatcccggagcagctgcgatacgccgagatgctgcatccg
gaacacctggctgagactgcccgccggtga

DBGET integrated database retrieval system