KEGG   Mycolicibacter sinensis: JDM601_3050Help
Entry
JDM601_3050       CDS       T01512                                 

Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00380  Tryptophan metabolism
mjd00630  Glyoxylate and dicarboxylate metabolism
mjd01110  Biosynthesis of secondary metabolites
mjd01130  Biosynthesis of antibiotics
mjd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    JDM601_3050
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    JDM601_3050
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     JDM601_3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI SurA_N_3 SurA_N_2
Motif
Other DBs
NCBI-ProteinID: AEF37050
UniProt: F5Z250
LinkDB All DBs
Position
complement(3257827..3259968)
Genome map
AA seq 713 aa AA seqDB search
MATEDPKQRQLDEHRYDRQSGYLTTQQGLRVDHTDDALTAGERGPTLLEDFHAREKVMHF
DHERIPERVVHARGSGAYGYFEPYDDSLAEYTAAKFLTSPGTKTPVFVRFSTVAGFRGSA
DTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAQSAH
DTLWDFVSLQPETLHAIMWLMSDRSLPRSFRMMQGFGVHTFRFVNAKGQGTFVKFHWKPK
LGVHSLIWDECQKIAGKDPDFNRRDLWDSIEAGQYPEWELGVQLVAESDEFNFDFDLLDA
TKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFCTANVVPGIDFTNDPLLQFRNFSYL
DTQLIRLGGPNFNHLPINRPVAPVHTNQHDGYSQHAIPVGKSSYYKNSLGGGCPALAGGD
DEVYRHYTQKVDGDKIRKRAASFENHYSQARMFYKSMSEPEAKHIVAAYAFELGKCETVE
IRQRVVEQLNHIDHDLARQVAEKLGLSAPDERQLDAAAEKVGTSPALSQLHAATVPPESR
GAPTIESRKIAVLAADGVDVTGVQSFVEAMRRRGAVAEVLAPTGGGELAGGSGGQLGVDR
AITTMASVLYDAVVVPCGPEAMHTLAADGYAMHFITEAYKHLKPIGAFGAGVELLPKAGI
VERLAEDTGVTVSTGVVTTAAAAGDLGEEFFDAFAAVLAKHRVWDRAADAVPA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
gtggctaccgaggaccccaagcagcgacagctcgacgagcaccggtacgaccggcagtcc
gggtacctgaccacccagcaggggctgcgggtcgaccacaccgacgacgcgctgacggcc
ggggagcgcgggcccacgttgctggaggatttccacgcccgggagaaggtcatgcacttc
gaccacgagcggatccccgagcgggtggtgcacgctcgcgggtcgggcgcctacggctac
ttcgagccctacgacgattcgctcgccgagtacaccgcggcgaagttcctgacctcgccg
ggtaccaagaccccggtgttcgtgcggttctccaccgtggccggcttccgcggatcggcc
gacaccgtgcgcgacgtgcgcgggttcgccaccaagttctacaccgaacagggcaactac
gacctggtgggcaacaacttcccggtgttcttcatccaggacggcatcaagttccccgac
ttcgtgcacgcggtgaagcccgaaccggacaacgagatcccgcaggcgcagtccgcccac
gacacgctgtgggacttcgtgtcgctgcagcccgagacgctgcacgccatcatgtggctg
atgtcggaccgttcattgccgcgcagcttccggatgatgcagggcttcggtgtgcacacc
ttccgcttcgtcaacgccaaggggcagggcacgttcgtgaagttccactggaagcccaag
ctcggcgtgcattcgctgatctgggacgaatgccagaagatcgccggaaaagacccggac
ttcaaccgccgcgacctgtgggattcgatcgaggccggccaatacccggagtgggagctg
ggtgtgcaattggtggccgagagcgacgaattcaatttcgatttcgatctgctggacgcc
acgaagatcatccccgaggaacaggttccggtgcgtccggtgggcaaaatggtgctcaac
cgcaacccggacaacttcttcgccgaaaccgagcaggtggccttctgcacggccaacgta
gtgccgggaatcgatttcaccaacgacccgctgctgcagttccgtaacttctcctacctg
gacacccagttgatccggctcggcggaccgaacttcaaccatctgccgatcaaccggccg
gtggcgccggtgcacaccaaccagcacgacggctacagccaacacgccatcccggtcggc
aagtccagctactacaagaactcgctgggcggcggctgcccggctctggccggcggtgac
gacgaggtgtaccggcactacacccagaaggtggacggcgacaagatccgcaaacgcgcc
gccagcttcgagaaccactacagccaggcgcggatgttctacaagagcatgtccgagccg
gaggccaagcacatcgtcgccgcgtacgcgttcgaactgggcaaatgcgaaaccgtcgag
atccggcagcgcgtggtcgagcaactcaaccacatcgaccacgacctggcgcgccaggtg
gccgagaagctggggctgtcggcgcccgatgagcgccagctcgatgccgcagccgagaag
gtcgggacgtcgccggcgctctcgcaactgcacgccgccaccgttccgccggagtcccgg
ggcgcgcccaccatcgaaagccgcaagatcgcggtactggcggctgacggtgtcgacgtt
acgggcgtccaaagcttcgtcgaggcgatgcgccggcgcggcgccgtcgccgaagtactg
gccccgaccggcggcggcgaactcgccggcggctcgggtgggcagctgggcgtcgaccgg
gcgatcaccaccatggcctcggtgctctatgacgcggtggtggtgccgtgtggtccggag
gcgatgcacacgctcgccgccgacggctacgccatgcatttcatcaccgaggcctacaaa
cacctgaagcccatcggggcgttcggggccggtgtcgagctgttacccaaagcgggaatc
gtcgagcggttggccgaggacaccggggtcaccgtctcgaccggcgtggtcaccaccgcg
gcggccgccggcgatctgggtgaggagttcttcgacgccttcgccgcggtgctggccaag
caccgggtctgggaccgggcggccgacgcggtgcccgcctag

DBGET integrated database retrieval system