KEGG   Mycolicibacter sinensis: JDM601_3125Help
Entry
JDM601_3125       CDS       T01512                                 

Gene name
glpD2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase GlpD2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00564  Glycerophospholipid metabolism
mjd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    JDM601_3125 (glpD2)
Enzymes [BR:mjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     JDM601_3125 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 NAD_binding_8 3HCDH_N Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: AEF37125
UniProt: F5Z310
LinkDB All DBs
Position
complement(3323335..3324978)
Genome map
AA seq 547 aa AA seqDB search
MVVGGGVVGTGCALDAATRGLKVALVEARDFAAGTSSRSSKMFHGGLRYLEQLEFGLVRE
ALHERELSLTTLAPHLVKPLPFLYPLTNRWWERPYVAAGIFLYDQLGGAKSVPAQRHLTR
AGALRLCPGLKRSALIGGIRYFDTVVDDARHTLTVGRTAAHYGAVIRTSTQVVALLREGD
RVTGVTVRDSENGATTEVRGHVVVNATGVWTDEIQALSRQRGRFHVRASKGVHIVVPRDR
IVSEAAIILRTEKSVLFVIPWGTHWIIGTTDTDWNLDLAHPAATKADIDYLLANVNTALA
TPLSHADIEGVYAGLRPLLAGENDDTSKLSREHAVAVPAPGLVAIAGGKYTTYRVMAADA
IDAAAEFIPTRVAPTITEKVPLLGADGYFALVNQAEHVGAEQDVHPYRVRHLLDRYGSLI
HDVLALAEERPELLDPIAEAPTYLKVEVAYAAAAEGALHLEDVLARRTRISIEYAHRGVN
CAREVAEVMAAVLGWDDAAVDAEVANYSARVEAEILSQEQPDDASADALRARAPEARTEI
LEPIPLP
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtcggcggcggtgtggtgggtaccggctgcgcgctggatgcggccacccgcggc
ctgaaggtcgcactcgtcgaggcgcgggacttcgccgccggaacgtcgagccgaagctcg
aagatgttccacggcgggctgcgctacctcgaacagctggagttcggcctggtgcgcgag
gcgctgcacgaacgcgaactgtcgctgaccacgctggcgccgcacctggtcaaaccgctg
ccgttcctctatccgctgaccaaccggtggtgggagcggccgtatgtggccgccggcatc
ttcctctacgaccagctgggcggagcgaaatcggttcccgcgcaacggcatctgacccgc
gccggcgcgctgcggctgtgcccggggctcaagcgcagcgcgctgatcggcggcatccgg
tacttcgacaccgtcgtcgacgacgcccgccacaccctgaccgtcgggcgcaccgcggcg
cactacggcgcggtcatccgcacctccacccaagtcgtggcgctgttgcgggagggcgac
cgggtgaccggggtgacggtgcgcgactccgagaacggcgcgacgaccgaggtgcgcggg
cacgtggtggtcaacgccaccggggtgtggaccgacgagatccaggcgctgtcacgtcag
cgcggccggttccacgtccgggcgtccaagggcgtgcacatcgtggtgccgcgcgaccgg
atcgtgtccgaggcggcgatcatcttgcgcaccgagaagtcggtgctgttcgtcatcccg
tggggcacgcactggatcatcggcaccaccgacaccgactggaacctggacctggcccac
ccggcggccaccaaggccgacatcgactacctgctggccaacgtcaacaccgcgctggcc
accccgttgagccacgccgacatcgagggcgtctatgccgggctgcggccgctgctggcc
ggggagaacgacgacacctccaagctgtcgcgggagcacgcggtggccgtgcccgcgccg
ggcctggtggctatcgccggcggcaagtacaccacctaccgggtgatggccgccgacgcg
atcgacgccgccgccgagttcattccgacccgggtggcgccgacgatcaccgagaaggtg
ccgctgctgggtgccgacggctacttcgcgctggtcaaccaggccgagcacgtcggcgcc
gagcaggacgtgcacccgtatcgggtgcgccacctgctggaccgttacggctcgctgatc
cacgacgtgttggcgctggccgaggagcggccggagctgctggacccgatcgccgaggcg
cccacgtacctgaaggtagaggtcgcctacgccgcggccgccgagggcgcgctgcactta
gaggacgtgctggcccgccggacgcggatctccatcgagtacgcccatcgcggggtgaac
tgcgcccgcgaagtcgccgaggtgatggcggcggtgctcggttgggacgacgccgcggtg
gacgcggaggtggctaactactccgctcgggtggaggccgagatcctgtcgcaggaacag
cccgatgacgcttcggcggacgcgctgcgggccagggcgcccgaagccaggacagagatt
ctggaaccgattccgcttccatga

DBGET integrated database retrieval system