KEGG   Mycolicibacter sinensis: JDM601_3243Help
Entry
JDM601_3243       CDS       T01512                                 

Gene name
alr
Definition
(GenBank) alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd00473  D-Alanine metabolism
mjd01100  Metabolic pathways
mjd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mjd00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    JDM601_3243 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    JDM601_3243 (alr)
Enzymes [BR:mjd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     JDM601_3243 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mjd01011]
 Precursor biosynthesis
  Racemase
   JDM601_3243 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEF37243
UniProt: F5YXN9
LinkDB All DBs
Position
complement(3448271..3449431)
Genome map
AA seq 386 aa AA seqDB search
MTATSRTAGLLGEALVDLDAIAHNVRVLSDQAGAAEVMAVVKADGYGHGAAQVARAALAA
GAAELGVATVDEALALRAAGIAAPVLAWLHGPDTDFAPALTADVQIAVSSVRQLDELLDA
VGRSGRTATVTVKADTGMNRNGIGAAGYPELLGALRRAVADDAIRVRGLMSHLACADEAD
NPVNNVQAQRFSDMLALARDNGLTFEVAHLANSAGVMTRPDLAFDMVRPGIAVYGLSPLP
ERGDMGLVPAMTLKSIVVLVRSIKAGEAVSYGHTWIAEADTTLALVPMGYADGVFRPLSG
RFDVLINGRRRPSVGRVCMDQFVVDLGPGPVDVTEGDEVILFGPGTNGEPIAQDWADALG
TIHYEVVNSPRGRVARTYRGDGSDGR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacatcccgaacggccggcctgctcggcgaagccctggtggacctggatgcc
atcgcgcacaacgtgcgggtgctgtctgaccaggccggtgccgccgaggtgatggccgtg
gtcaaagccgacggctacggccacggcgccgcccaggtggcgagagcggcattagcggcc
ggagcagccgaactcggggtcgccaccgtcgacgaggcgctggcgttgcgggcggccggt
atcgccgccccggtcctggcgtggctgcacgggcccgacaccgacttcgcgcccgccttg
accgccgacgtgcagatcgcggtctcctcggtgcggcagctcgacgagttgctcgacgcc
gtgggccgcagcggccgcaccgccacggtgacggtcaaggccgacaccggcatgaaccgc
aacggcatcggtgccgcaggctaccccgagctgctgggtgcgctgcgccgcgccgttgcc
gacgacgcgattcgggtgcggggcctgatgtcgcacctggcctgtgctgacgaagcggac
aacccggtgaacaatgttcaagcgcaacggttctccgatatgctcgcgctggcccgcgat
aatggcctgacgttcgaggtggcccacctcgcgaattctgccggggtgatgacccggccg
gacctggccttcgacatggtgcggcccggcatcgccgtctacgggctcagcccgctcccc
gagcgtggcgacatgggcctggtccccgccatgacgctgaaatccattgtggtgctggtc
cgctcgatcaaagccggcgaggcggtctcttacgggcacacctggatcgccgaggccgac
accacgctggcgctggtcccgatgggctacgccgacggcgtgttccgcccgctgagcggt
cggttcgacgtgctgatcaacggccggcgccggcccagcgtcggacgggtctgcatggac
cagttcgtcgtcgacctcggccccgggccggtcgacgtgaccgagggtgacgaggtcatc
ctgttcggacccggaaccaacggcgagccgatcgcccaggactgggccgatgcgctgggc
accatccactacgaggtggtgaactcaccgcgcggacgggtcgccagaacctaccggggg
gacgggtccgatggccgttaa

DBGET integrated database retrieval system