KEGG   Mycolicibacter sinensis: JDM601_3535Help
Entry
JDM601_3535       CDS       T01512                                 

Gene name
phoT
Definition
(GenBank) phosphate-transport ATP-binding protein ABC transporter PhoT
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
mjd  Mycolicibacter sinensis
Pathway
mjd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mjd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JDM601_3535 (phoT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mjd02000]
    JDM601_3535 (phoT)
Enzymes [BR:mjd01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     JDM601_3535 (phoT)
Transporters [BR:mjd02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    JDM601_3535 (phoT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 AAA_16 Rad17 AAA_30 RsgA_GTPase AAA_33 AAA_15 AAA_18 AAA_23 AAA_28 PRK G-alpha RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AEF37535
UniProt: F5Z0J0
LinkDB All DBs
Position
complement(3743175..3743939)
Genome map
AA seq 254 aa AA seqDB search
MDLTDLNIYYGAFHAVADVTLSVAPRSVTAFIGPSGCGKSTVLRTLNRMHEVISGARVDG
SVLLDGEDIYGPSIDPVGVRKAIGMVFQRPNPFPTMSIRDNVVAGLKLQGVRNRKLLDET
AEHSLRGANLWNEVKDRLDRPGGGLSGGQQQRLCIARAIAVQPDVLLMDEPCSALDPIST
MAIEELIAQLKQDYTIVIVTHNMQQAARVSDQTAFFNLEAVGKPGRLIEIDGTEKVFSNP
SCKETEDYISGRFG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttggacctgaccgatctcaacatttattacggggccttccatgccgttgccgacgtgacg
ctgtcggtcgccccgcgcagcgtgaccgcgttcatcggaccgtccggatgcggcaagtcg
acggtgttgcgcaccttgaaccggatgcacgaggtcatctccggcgcccgggtggacggg
tcggtgctgctcgacggtgaggacatctacggcccgtcgatcgatcccgtcggggtgcgg
aaggccatcggcatggtcttccagcgtccgaacccgtttcctaccatgtcgatccgcgac
aacgtggtcgccgggctgaagttgcagggtgttcgcaaccgcaagctactcgacgagacc
gcggagcattcgctgcgcggcgccaacctgtggaacgaggtgaaggaccggctggacagg
cccggcggcgggctgtcgggcgggcagcagcagcgattgtgtatcgcccgggccatcgcg
gtgcagcccgacgtgctgttgatggacgagccctgttcggcgctggacccgatttcgacg
atggccatcgaggagttgatcgctcaactcaagcaggactacaccatcgtcatcgtcacc
cacaacatgcagcaagctgcccgggtcagtgaccagaccgcgtttttcaacctcgaggcc
gttggcaaaccgggccggctgatcgagatcgacggcaccgagaaggtcttctccaacccc
agctgcaaggagaccgaggactatatctcgggccggttcggctga

DBGET integrated database retrieval system