KEGG   Mycolicibacter sinensis: JDM601_4023Help
Entry
JDM601_4023       CDS       T01512                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
mjd  Mycolicibacter sinensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AEF38023
UniProt: F5YT34
LinkDB All DBs
Position
complement(4275207..4276259)
Genome map
AA seq 350 aa AA seqDB search
MVLIDMMDTMDLPVAPPVDPMLAKAAVKVPADAGRWSYEPKWDGFRAIVFRDGDEVLLQS
RNGKPLGRYFPELLEALRAEVGPRCVLDGEVVVPRQIDGRTRLDWESLSQRIHPADSRVR
LLAEQTPAQFIGFDALATGSVSLLDEPFRVRRQALADSIHAGPSCHVTRATDDPEQATVW
LTSFEGAGLDGVVAKRTDGPYLPGKREMVKVKHRRDADCVVMGYRIHKSGNGIGSLLLGL
YRPDGELAMVGGAASFTDADRLALLAELEPLRIGDVREGEPSRWNSAADKQWVPIRPERV
AEVAYDQMEGDRFRHTVKLLRWRPDRDPASCTFDQLDVPLTYDLVDVLET
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtggttctcatcgacatgatggacaccatggacctgcccgtagcgccgccggtggatccg
atgctggccaaggctgcggtcaaggttccggccgacgcggggcgctggtcctacgagccc
aagtgggacggctttcgcgccatcgtgttccgcgacggcgacgaggtgttgctgcaatcg
cgcaacggcaaacccttgggccgctacttcccggaactgctggaggcgttgcgcgccgag
gtgggcccgcgctgcgtgctcgacggggaggtggtggtgccccggcagatcgacggccgg
acccggctggactgggagtcgctgagccagcggatccatcccgccgacagccgggtgcgg
ctgctggccgagcagaccccggcgcagttcatcggcttcgacgcgctggccaccggttcg
gtgtcgctgctcgacgaaccgttccgggtgcgacggcaggcgctggcggactcgatccac
gccggtcccagctgtcatgtcacccgcgccaccgacgatcccgagcaggccacggtctgg
ctcacctcgttcgagggcgccgggctcgacggggtggtcgccaagcggaccgacgggccg
tatctgcccggcaagcgcgagatggtcaaggtcaaacaccgccgggacgccgactgtgtg
gtgatgggataccgaatccacaagagcggcaacggtatcggttcgctgctgctggggctg
taccgtcccgacggtgagctggcgatggtcggcggcgcggcgtcgttcaccgatgccgac
cggctggcgctgctggccgagctggagccgctgcggatcggtgacgtccgcgagggcgag
cccagccgctggaactccgcggccgacaagcagtgggtgccgatccggcccgagcgcgtc
gccgaggtcgcctacgaccagatggagggcgatcgcttccggcacaccgtgaaactgctg
cggtggcgccccgaccgcgacccggccagctgcaccttcgaccaactcgacgtcccgttg
acctacgatctcgtcgacgtgctggagacctga

DBGET integrated database retrieval system