KEGG   Methanocaldococcus bathoardescens: JH146_0004Help
Entry
JH146_0004        CDS       T03253                                 

Definition
(GenBank) CO dehydrogenase/acetyl-CoA synthase alpha subunit
  KO
K00192  anaerobic carbon-monoxide dehydrogenase, CODH/ACS complex subunit alpha [EC:1.2.7.4]
Organism
mjh  Methanocaldococcus bathoardescens
Pathway
mjh00680  Methane metabolism
mjh01100  Metabolic pathways
mjh01120  Microbial metabolism in diverse environments
mjh01200  Carbon metabolism
Module
mjh_M00422  Acetyl-CoA pathway, CO2 => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mjh00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    JH146_0004
Enzymes [BR:mjh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.4  anaerobic carbon-monoxide dehydrogenase
     JH146_0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prismane Fer4_17 Fer4_7 Fer4_9 Fer4_8 Fer4_16 Fer4_10 CODH_A_N Fer4 Fer4_21 Fer4_4 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AIJ04855
UniProt: A0A076L958
LinkDB All DBs
Position
complement(2491..4812)
Genome map
AA seq 773 aa AA seqDB search
MGNNIEMDVKKLLTPLVKMKNANISMSVKFGEAEEEEDWEPMGPTPKPKVPTLRHWDFKL
LERYPPFYMPICDLCCLCTFGKCDLSRGKKGACGLNIKAQQARIVLIACCIGTACHTGHS
RHLVHHLIEKLGKDYPINLGNEIEVEAPITRTVMGIRPKTLGDLEKILDYCEEQITHLLS
AAHTGQEGDYLDFESKAFHAGMIDDLAREVGDIAQIVAYNMPKGDEDAPLIELGFGCIDK
SKPVILCIGHNVVPGSYILEYLEENNMEDDVEVCGICCTAIDISRVSDKAKIVGPLSRQL
MFVRSGVADVVVVDEQCIRTDILEEVLKTGAVLIATNEKMCLGLEDVSHLSEDEIIGYLL
RNRAALILDEEKVGKVAVEVAKIVAKERKDRKTLPDLNEVVELAKQCTECGWCNRNCPNA
FKVKEAMTLAKQGNFDGFVDLYKKCYSCGRCETICPRNLPIVSMTTKVGEAYYKDLKFKI
RAGRGPIKDVEIRSVGAPIVFGDIPGVVALVGCSNHPNGEEEVALIAKEFLERKYIVVTS
GCAAMSIAMWKDKDGKTLYEKYPGEFRAGGLVNCGSCLSNCHITGAAIKIANIFAKVPLR
GNYAEVADYILNKVGAVGVAWGAMSQKAAAIATGVNRWGIPVIVGPHGAKYRRLYLSNGE
KFKVKDKKTGEILEIDPVPEHLIVTAENVKECICMIPKLCMRPNDNPKGRANKIYHYVDL
YEKYFGKMPPDLEKFVRTEKDIPFMMKDKIMAYLEEKGWKPLEKYPQDPTILY
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggggaataacatagaaatggatgtcaaaaaacttctcacgcctttagttaagatgaaa
aacgccaatatatcaatgagtgtaaagtttggtgaagcagaggaggaagaagattgggaa
ccaatgggacctacaccaaaaccaaaagttcctacattaagacattgggattttaaacta
ttggaaagatatcctcccttttatatgccaatctgtgatttgtgttgtttatgtacattt
ggaaagtgtgatttaagcagaggaaagaaaggggcttgtggtttaaatattaaagcacaa
caggcaaggatagttttaatcgcttgctgtattgggactgcatgtcacacagggcatagt
aggcatttagttcatcacctaattgaaaagttagggaaggactatccaattaatttaggc
aatgagatagaggttgaagcaccaataacaagaactgtcatgggcattagaccaaaaact
ttaggagatttagagaaaattttagattattgtgaagagcaaataactcatctcttatca
gcagcacatactggacaagagggagattacttagattttgagagtaaagcattccatgca
ggaatgattgatgatttagcaagggaagttggagatatagctcaaatagttgcttacaac
atgccaaaaggagatgaagacgctcctttgatagagttaggatttggttgtatagataag
agtaagccggttatcttatgtatagggcataatgtagttccaggtagttatatattggaa
tatttagaagaaaataatatggaagatgatgtagaggtttgtggtatctgctgtacagct
atagatatctcaagagtttcagataaagcaaagattgttgggcctttatcaagacagttg
atgtttgttagaagtggagttgcagatgttgttgttgtagatgagcagtgtattagaaca
gatattttagaagaggttttaaaaactggggctgtgttgattgcaacaaatgaaaagatg
tgcttaggtttagaggatgtttcacatttaagtgaagatgaaattattggctacttatta
agaaatagagcagctttaattttagatgaagaaaaagttggaaaagttgctgttgaagtt
gctaaaatagttgctaaagaaagaaaggacagaaagactctaccagatttaaatgaagtt
gttgaattggcaaagcaatgcactgaatgtggatggtgtaacagaaactgtcctaacgca
tttaaggttaaagaagcaatgactttagcaaaacaaggtaattttgatggatttgttgat
ttatacaaaaaatgttacagctgtggaagatgtgaaacaatctgtccaaggaatttgcca
atagttagcatgacaacaaaagtaggagaagcttattacaaagatttaaaattcaagata
agagctggaagagggcctatcaaagatgttgaaattagaagtgttggggcaccaattgta
tttggagacatcccaggagttgttgctttagttggctgttcaaaccatccaaatggtgaa
gaagaagttgccttaatagcaaaagagttcttggagaggaaatatatagttgtaacatct
ggttgtgctgcaatgtcaattgcaatgtggaaggataaagatggaaaaacattatatgaa
aaatatccaggtgagttcagagcaggagggcttgtaaattgtggttcttgtctatcaaat
tgccacattaccggagctgctataaaaatagctaacatctttgctaaagttccgttaaga
gggaactatgctgaagttgctgattacatactaaacaaggttggagctgttggagttgca
tggggagctatgagtcaaaaagctgctgcaattgctactggagtcaatagatggggaata
cctgttattgtaggaccacatggggctaagtatagaagactatacctaagcaatggagag
aaattcaaagttaaagataaaaaaacaggagaaattttagagatagaccccgttcctgaa
catctaattgtaactgctgaaaatgttaaagaatgtatctgcatgattccaaagctatgt
atgaggccaaatgacaatccaaaaggtagagctaacaagatttaccactacgttgattta
tatgaaaaatactttggaaagatgccacctgatttagaaaaattcgttagaactgaaaaa
gacattcctttcatgatgaaagataagataatggcttacttggaagagaaaggatggaaa
cctcttgaaaaatatccacaagacccaactatactgtattaa

DBGET integrated database retrieval system