KEGG   Methanocaldococcus bathoardescens: JH146_0157Help
Entry
JH146_0157        CDS       T03253                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mjh  Methanocaldococcus bathoardescens
Pathway
mjh00010  Glycolysis / Gluconeogenesis
mjh00020  Citrate cycle (TCA cycle)
mjh00620  Pyruvate metabolism
mjh00633  Nitrotoluene degradation
mjh00640  Propanoate metabolism
mjh00650  Butanoate metabolism
mjh00680  Methane metabolism
mjh00720  Carbon fixation pathways in prokaryotes
mjh01100  Metabolic pathways
mjh01120  Microbial metabolism in diverse environments
mjh01130  Biosynthesis of antibiotics
mjh01200  Carbon metabolism
Module
mjh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mjh_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mjh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JH146_0157
   00020 Citrate cycle (TCA cycle)
    JH146_0157
   00620 Pyruvate metabolism
    JH146_0157
   00640 Propanoate metabolism
    JH146_0157
   00650 Butanoate metabolism
    JH146_0157
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    JH146_0157
   00680 Methane metabolism
    JH146_0157
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    JH146_0157
Enzymes [BR:mjh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     JH146_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DUF2524 MannoseP_isomer SAT
Motif
Other DBs
NCBI-ProteinID: AIJ05008
UniProt: A0A076LF33
LinkDB All DBs
Position
143435..144595
Genome map
AA seq 386 aa AA seqDB search
MCEVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLAEFVANGELDAEYIKVESEH
SAMSACIGAAATGARTFTATASQGLALMHEMLFIASGMRLPIVMMVANRALSAPINIWND
HQDSISERDSGWIQIYVEDNQETLDSIIQAYKIAENEDVLLPVMVCLDGFILTHTVEPVT
IPKAERVREFLGVYEPKHAYLDPDRPVTQGPVGVPDCYMETRKQVEEAMERAKKVIKEVN
EEFAERFKRKYGNGLVEAYNLDKADTVLVAMGSVCGTIKYVIDELKKEGKEVGLLRIRTY
RPFPKEDVRELLKDAENIAVLDKNISFGFNKGALGIEMASILKNKKVCNYIVGLGGRDIK
IDDIKTIINHVEKAEDDTTLWIGLKE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagttaaagttattacaggaacttcagctgctgctgaagcggctaaattagct
gatgttgatgttatagctgcttatccaatcacaccacaaacaacatgtgttgagaagtta
gctgagtttgtagccaatggagagttggatgctgagtatataaaggttgaaagtgagcac
tcagcaatgtctgcctgtattggagctgctgcaacaggagcaaggacatttactgcaact
gcctcacaaggtttagctttaatgcatgaaatgttattcattgcatcaggtatgagatta
ccaatagttatgatggttgctaacagagctttatcagcccctataaacatttggaacgac
catcaggattcaatatcagagagagatagtggatggattcagatatatgttgaagacaac
caagaaacacttgatagcattattcaagcttacaaaattgctgaaaatgaagatgtttta
ttgccagttatggtttgtttagacggatttatcttaactcacacagtagaaccagtaaca
attccaaaggcagaaagagttagagaatttttaggtgtttatgaaccaaaacacgcatat
ttagacccagatagaccagtgactcaagggcctgttggagttccagattgctatatggaa
acaagaaagcaggtagaggaagcaatggaaagagccaaaaaagtaattaaagaagttaat
gaggaatttgctgaaagatttaagagaaaatatggaaatggtttagttgaagcatacaac
ttagataaagcagatacagttttagttgcaatgggttctgtctgtggaacaataaaatac
gttattgatgagcttaaaaaagaaggaaaagaagttgggttgttgagaataagaacctac
aggccattcccaaaagaggatgttagagagcttttaaaggatgcagaaaatatagctgtg
ttagataaaaacatctcatttggatttaataagggagctttaggaattgaaatggcatca
attttaaagaataagaaggtttgcaactacattgttggattaggtggaagagacatcaaa
atagatgatataaaaacaataattaatcatgttgagaaagcagaggatgatacgacttta
tggattggattgaaagaataa

DBGET integrated database retrieval system