KEGG   Methanocaldococcus bathoardescens: JH146_0608Help
Entry
JH146_0608        CDS       T03253                                 

Definition
(GenBank) Ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mjh  Methanocaldococcus bathoardescens
Pathway
mjh00630  Glyoxylate and dicarboxylate metabolism
mjh01100  Metabolic pathways
mjh01120  Microbial metabolism in diverse environments
mjh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mjh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    JH146_0608
Enzymes [BR:mjh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     JH146_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AIJ05457
UniProt: A0A076LF50
LinkDB All DBs
Position
612626..613903
Genome map
AA seq 425 aa AA seqDB search
MDYINLNYTPNENDLLSCMIIKGENLEKLANEIAGESSIGTWTKVQTMKSDIYEKLRPKV
YEIKEIGEENGYKVGLIKIAYPLYDFEINNMPGVLAGIAGNIFGMKIAKGLRILDFRFPE
EFVKAYKGPRFGIEGVRETLKIKERPLLGTIVKPKVGLKTEEHAKVAYEAWVGGVDVVKD
DENLTSQEFNKFEDRIYKTLEMRDKAEEETGERKAYMPNITAPYREMIRRAEIAEDAGSE
YVMIDVVVCGFSAVQSFREEDFKFIIHAHRAMHAAMTRSKDFGIAMLALAKIYRLLGVDQ
LHIGTVVGKMEGEEKEVKAIRDEIVYDKVEADNENKFFNQEWFDIKSVFPVSSGGVHPRL
VPKIVEILGKDLIIQAGGGVHGHPDGTIAGAKAMRAAIEAVVEKKSLEEKAEEVEELKKA
LEYWK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggactatataaacttaaactacacaccaaacgaaaatgacttgttgtcttgtatgata
atcaaaggtgaaaacttagaaaaattggcaaatgaaattgctggggaaagttctattggg
acatggactaaagttcaaacaatgaaaagcgatatttatgaaaaattaagaccaaaagta
tatgaaattaaagagattggggaagaaaatggatacaaagttggactaataaaaattgca
tatccattgtatgattttgaaataaacaacatgccaggggttttagcagggattgcagga
aatatatttggaatgaaaatagctaaaggtttaagaatattagactttagattcccagaa
gaatttgttaaagcttataaagggccgagatttggaattgaaggagttagagaaactttg
aagattaaagagagacctctattagggactattgttaagccaaaagttggtttaaaaact
gaagagcatgcaaaggtagcttatgaagcatgggttggaggggtagatgtcgttaaagat
gatgaaaatttaacttctcaagaattcaacaaatttgaagataggatttataaaacctta
gagatgagagataaagcagaggaagagaccggagaaagaaaagcttatatgccaaacata
acagccccatatagagagatgattaggagggcagagattgctgaagatgctggaagtgag
tatgtgatgatagatgttgttgtttgtggattctctgcagtgcaatcatttagagaagaa
gatttcaaatttataatccacgcccatagagctatgcatgcagcaatgacaagaagcaaa
gattttggaatagctatgcttgcattggctaaaatttataggttattgggagttgaccaa
ttgcatataggaacggttgttggaaagatggaaggtgaagaaaaggaagttaaagcaatt
agggatgagattgtttatgataaagttgaggcagataatgaaaataagttctttaatcaa
gagtggtttgatattaaatcagtattccctgtttcttctggaggagttcatccaagatta
gttccaaaaatagttgagattttaggaaaagatttaattattcaagcagggggaggggtt
cacggacatccagatggaactatagctggagctaaggcaatgagggccgctattgaggca
gtcgtagagaaaaaatcattagaagaaaaagcagaagaagttgaagaattaaaaaaggct
ttagagtattggaaataa

DBGET integrated database retrieval system