KEGG   Mycobacterium sp. JLS: Mjls_0016Help
Entry
Mjls_0016         CDS       T00482                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mjl  Mycobacterium sp. JLS
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjl01001]
    Mjls_0016
Enzymes [BR:mjl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Mjls_0016
Protein kinases [BR:mjl01001]
 Serine/threonine kinases: Other
  Bacterial family
   Mjls_0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal Haspin_kinase Kinase-like RIO1
Motif
Other DBs
NCBI-ProteinID: ABN95829
LinkDB All DBs
Position
complement(17655..18986)
Genome map
AA seq 443 aa AA seqDB search
MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAIKVLKAEYSTDPEFVERFRA
EARTVAMLNHPGIASVYDYGETDMDGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQVAHTAGLVHRDVKPGNILITPTGQVKLTDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDATAASDVYALGVVGYESVSGKRPFTGDGALTVAMKHIKETPPPLPAD
LPPNVRELIEITLVKNPGMRYRSGGPFADAVAAVRSGRRPPRPNQAPSIGRATPAAVPSA
AQARAAADLTGRAPVTAARARPTGAIHRPPPPRRTFSSGQRALLWAAGVLGALAIVIAIL
IVLNAQDRKDRQLPPPTVTNTITETTPYQSPAAMPEWMPDWTSSAVIGHGGDTSGAVRPD
AVAASAHLRALPAPAQTWLRTQT
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagcccccgcgtcggcgtcaccctgtccggccgctaccggctccagcgactcatcgcc
accggcggtatgggtcaggtctgggaggccgtcgacagcaggctgggccgtcgtgtcgcc
atcaaggtcctcaaggccgagtactccaccgacccggagttcgtcgaacggttccgcgcc
gaggcacgcaccgtcgcgatgctcaaccaccccggcatcgccagcgtctacgactacggc
gagaccgatatggacggggaaggccgcaccgcgtacctggtgatggagctcgtcaacggc
gaaccgttgaactcggtgctcaagcgcaccggacgcctctcgctgcggcacgccctggac
atgctcgagcagaccggacgcgcgttgcaggtcgcccacaccgccggtctggtgcaccgc
gacgtcaaacccggcaacatcctcatcaccccgaccggtcaggtgaagctcaccgacttc
ggcatcgccaaggccgtcgacgcggccccggtcacccagaccggcatggtgatgggcacc
gcgcagtacatcgcgcccgaacaggccctcggccacgacgcgaccgccgccagcgacgtc
tacgcactgggggttgtcggctacgaatccgtctcggggaagcggcctttcaccggtgac
ggggccctgaccgtggcgatgaaacacatcaaggagaccccgccgccgctgcctgccgat
ctgccgccgaacgtgcgtgagctgatcgagatcacgctggtgaagaaccccggtatgcgc
taccgctccggcggaccgttcgccgacgcggtcgcggccgtgcgctcggggcggcgtccg
ccgcggccgaaccaggcaccgagcatcgggcgcgccacccccgccgccgtgccctcggcg
gcgcaggcccgcgcggccgccgatctcaccggccgggcgccggtcaccgccgcccgcgcc
cgtcccaccggtgccatccaccggccgccaccaccgcggcgcacgttctcctccggtcag
cgcgcgctgctgtgggccgccggcgtgctgggcgcgctggcgatcgtcatcgccatcctg
atcgtgctcaacgcccaggaccgcaaggaccgccaactgccaccgccgacggtgacgaac
accatcaccgagaccacgccgtaccaatcgcccgccgccatgcccgagtggatgcccgat
tggacctcgtctgcggtcatcggtcatggtggagacacatccggggcagtccgccccgac
gcggttgccgcatccgcgcacctacgggcgctgcccgcccctgcacagacatggctccga
acacagacatga

DBGET integrated database retrieval system