KEGG   Mycobacterium sp. JLS: Mjls_0428Help
Entry
Mjls_0428         CDS       T00482                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00220  Arginine biosynthesis
mjl00250  Alanine, aspartate and glutamate metabolism
mjl00290  Valine, leucine and isoleucine biosynthesis
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01130  Biosynthesis of antibiotics
mjl01210  2-Oxocarboxylic acid metabolism
mjl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mjls_0428
   00290 Valine, leucine and isoleucine biosynthesis
    Mjls_0428
   00220 Arginine biosynthesis
    Mjls_0428
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mjl01007]
    Mjls_0428
Enzymes [BR:mjl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Mjls_0428
    2.6.1.66  valine---pyruvate transaminase
     Mjls_0428
Amino acid related enzymes [BR:mjl01007]
 Aminotransferase (transaminase)
  Class I
   Mjls_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Alliinase_C Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABN96240
LinkDB All DBs
Position
complement(472921..474207)
Genome map
AA seq 428 aa AA seqDB search
MDDVTMPQTPAERTWHAQGHQPRPRTFTQSSKLQDVLYEIRGPVHEHASRLEAEGHRILK
LNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGIMPARRAVFTRYELVDGFPRFDVD
DVFLGNGASELIQMVLQALLDNGDQVLIPAPDYPLWTACTSLAGGTPVHYLCDETQGWNP
DVADIESKITDRTKAIVVINPNNPTGAVYSRETLERIADLARKHQLLLLADEIYDKILYD
DAKHISLASVAPDVLTLTFNGLSKAYRVAGYRSGWLVITGPKEHASSFIEGISLLANMRL
CPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWEKLNEIPGVSCVKPAGALYAFP
RLDPEVYEIHDDELLVLDLLLQEKILVVQGTGFNWPTPDHLRIVTLPWARDLANAIERLG
NFLVSYRQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgtgaccatgcctcagacgccggccgagcggacctggcacgcccagggccac
cagccgcggccccgtacgttcacgcagtcgtcgaagctgcaggacgtcctctacgagatc
cgcggcccggtacacgagcacgcgtcccggctggaggccgagggccaccgcatcctcaag
ctcaacatcggcaacccggcgccgttcggcttcgaggcacccgacgtgatcatgcgcgac
atcatccaggcgctgccgtacgcgcagggctactcggactccaagggcatcatgcccgcg
cgccgggcggtgttcacccgctacgaactcgtcgacgggttcccgcgcttcgacgtcgac
gacgtgttcctcggcaacggggcctccgagctcattcagatggtgctgcaggcgctgctg
gacaacggcgatcaggtgctgatcccggcgccggactatccgctgtggacggcgtgcacc
tcgctggcgggcggcaccccggtgcactacctgtgtgacgagacgcagggctggaatccc
gacgtcgccgacatcgagtcgaagatcaccgaccgcaccaaggcgatcgtcgtcatcaac
ccgaacaacccgaccggcgcggtgtacagccgcgagacgctggagcggatcgccgatctc
gcgcggaaacaccagctgctgctgctggccgacgagatctacgacaagatcctctacgac
gatgccaaacacatctcactggcctcggtcgcgccggacgtgttgaccctgacgttcaac
gggctgtcgaaggcctaccgggtggcgggttaccgctcgggctggctggtgatcaccgga
cccaaggagcacgccagcagcttcatcgagggcatcagcctgctggccaacatgcggttg
tgcccgaatgtgcctgcacagcatgcgattcaggtggcgctcggcggccatcagagcatc
gacgatctggtgttgcccggcgggcggttgctcgagcagcgcgacgtggcctgggagaag
ctcaacgagattcccggcgtctcgtgcgtgaagccggccggcgcgctgtacgcgttccct
cgacttgatcccgaggtctacgagatccacgacgacgagctgctggtgctcgacctgctg
ctgcaggaaaagatcctggttgtgcagggcaccgggttcaactggccgacaccggatcac
ctgcgcatcgtcacgctaccgtgggcccgtgacctggccaatgccatcgagcgtctcggc
aacttcctggtcagctaccggcagtag

DBGET integrated database retrieval system