KEGG   Mycobacterium sp. JLS: Mjls_0707Help
Entry
Mjls_0707         CDS       T00482                                 

Definition
(GenBank) hypothetical protein
Organism
mjl  Mycobacterium sp. JLS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_3_6 DUF2615
Motif
Other DBs
NCBI-ProteinID: ABN96518
LinkDB All DBs
Position
complement(750432..751016)
Genome map
AA seq 194 aa AA seqDB search
MAAFRRVYGAHPLHLLTLIAGFALFGYAIVTLGFSALWNPRTWWQSIAVWFAAAVVAHDL
VLFPLYALTDRILMLSQRIPTPVPVLNHLRVPLLGAALTFVVFSPGILQQGAPAYTAATG
LTQEPYLGRWLLLVAAMFTLSAAVYAVRLGRPRQSATVSPASRVSDARRDADPSSPTPPP
PPARPHNPPPPTPT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgttccgcagggtgtacggcgcgcatccgctgcatctgctgacgctgatcgcc
ggcttcgcgctgttcggctacgccattgtgacgctcggcttttcggcgctgtggaatccg
cgcacctggtggcagtcgatcgcggtgtggttcgccgcggccgtcgtcgcccacgacctg
gtgctgttcccgctctacgcgctcaccgaccggatacttatgctctcccaacgtattccg
acacctgtgccggtgctcaaccacctgcgcgtacccctgctgggtgccgcactcacgttc
gtggtgttcagtccgggcatcctgcaacaaggtgcgcccgcctatactgcggccaccggc
ctgacgcaggaaccgtacctcggtcgctggctgctgctggtcgccgcgatgttcacgctc
agcgccgcggtgtacgcggtccggctggggcgtccccgacagtccgctacggtgtcgcca
gcgtcgcgagtatccgacgcccggcgggatgcagacccgtcatcaccaaccccgcctcct
ccgccagcgcggccgcacaatccacccccaccgacgcccacctga

DBGET integrated database retrieval system