KEGG   Mycobacterium sp. JLS: Mjls_1172Help
Entry
Mjls_1172         CDS       T00482                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00250  Alanine, aspartate and glutamate metabolism
mjl00410  beta-Alanine metabolism
mjl00430  Taurine and hypotaurine metabolism
mjl00650  Butanoate metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl02024  Quorum sensing
Module
mjl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mjls_1172
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mjls_1172
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mjls_1172
   00430 Taurine and hypotaurine metabolism
    Mjls_1172
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mjls_1172
Enzymes [BR:mjl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Mjls_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABN96975
LinkDB All DBs
Position
1248883..1250268
Genome map
AA seq 461 aa AA seqDB search
MSRTHSRVQHVSPAYTGRLAMAPVPSLRLPDEAMEPQAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHAEDLRDDDPNSAIG
VSTIGSSEAVMLAGLAMKWRWRQRLGGDAWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEDGRYVITPEQVLEHVDEDTIGVVAILGTTYTGELEPIGEICAALDKLAADGGVDVP
VHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRNAEQLPEEL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRGGYAQVMQSLSQTARWLGDELRD
SEHFELITDGSAIPVVSFRLKGDPGYTEFDISQTLRSYGWQVPAYTMPEGAEDVTVLRVV
VREGFSADLARALRDDMVTVLKHLDELKPGGHFDEVQPFAH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcacgcacagtcgcgtccagcacgtctcgcccgcctacaccggcaggttggcg
atggcgccggtgccgtcactgcggctgcccgacgaggcgatggaaccccaggcggcctac
cggttcatccacgacgaactcatgctcgacggcagctcgcggctcaacctcgccaccttc
gtcaccacgtggatggaccccgaggccgagaagctgatggccgagacgttcgacaagaac
atgatcgacaaggacgagtacccggcgaccgcggcgatcgagcagcgttgcgtgtgcatg
gtggccgacctgttccacgccgaggatctgcgcgacgacgacccgaacagcgcgatcggg
gtgtcgacgatcgggtcgagcgaggcggtcatgctcgccgggctggcgatgaaatggcgt
tggcgccagcgcctcggcggcgatgcgtggaagggccgcaccccgaatctggtgatgggg
tcgaacgtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccgcgctat
ctgccgatggaggacggtcgctacgtcatcactccggagcaggtgctcgagcacgtcgac
gaggacaccatcggagtggtggcgatcctgggcaccacctacaccggtgaactggagccc
atcggggagatctgcgccgcgctcgacaaattggccgcagacgggggtgtcgacgtgccc
gtccacgtcgacgccgccagcggcgggttcgtggtgccgttcctgcatccggatctggtg
tgggacttccggttgccgcgggtggtgtcgatcaacgtcagtggacacaagtacgggctc
acctatcccggcatcgggttcgtggtgtggcgcaacgccgagcagctacccgaggaactg
gtgttccgggtcaactacctcggcggcgacatgccgacgttcacgctgaacttctctcgt
cccggtaaccaggtggtcggccagtattacaacttcctgcggttgggtcgcggcggctac
gcgcaggtcatgcagtcgctgtcgcagaccgcccggtggctgggcgacgaactgcgcgac
agcgagcatttcgagttgatcaccgacggttcggcgatcccggtcgtgagcttccggttg
aagggcgacccgggctacaccgagttcgacatctcgcagacgttgcgctcctacggctgg
caggtgcccgcgtacaccatgcccgagggcgccgaggacgtcacggtgctcagggtcgtg
gtacgcgaggggttttccgccgatctggcccgcgcgctgcgcgacgacatggtcacggtg
ctcaagcatctcgacgagctcaagccgggtggccacttcgatgaggtgcagccgttcgcc
cattag

DBGET integrated database retrieval system