KEGG   Mycobacterium sp. JLS: Mjls_1253Help
Entry
Mjls_1253         CDS       T00482                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00020  Citrate cycle (TCA cycle)
mjl00190  Oxidative phosphorylation
mjl00650  Butanoate metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01130  Biosynthesis of antibiotics
mjl01200  Carbon metabolism
Module
mjl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mjl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mjl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mjls_1253
   00650 Butanoate metabolism
    Mjls_1253
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mjls_1253
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Mjls_1253
    1.3.5.4  fumarate reductase (quinol)
     Mjls_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4_7 Fer4_18 Fer4 Fer4_6 Fer4_16 Fer4_20 Fer4_15 Fer4_4 Fer4_3 Fer4_2 Fer4_21
Motif
Other DBs
NCBI-ProteinID: ABN97055
LinkDB All DBs
Position
complement(1330942..1331718)
Genome map
AA seq 258 aa AA seqDB search
MSAPAIEKNEATTPPVPEGAVMVTLKIARFNPEAPDDAGFQSFRVPCLPTDRLLNLLHYV
KWYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDMLPKNPKKQLTITIEPIRGL
PVEKDLVVDMEPFFDAYRAVKPYLMTSGNQPTKERIQSQVDRARYDDTTKCILCAACTTS
CPIYWTEGSYVGPAAIVNAHRFIFDSRDEGAAERLDILNDADGVWRCRTTFNCTEACPRG
IQITQAIQEVKRALMFAR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacctgcaatcgagaagaacgaagcgaccacaccgccggtgcccgagggcgcg
gtcatggtgacgctcaagatcgcccggttcaacccggaggcacctgacgacgccggcttc
cagagcttccgcgtcccgtgcctgcccaccgaccggctgctcaacctgctgcactacgtg
aagtggtacctcgacggcacgctgacgttccgccggtcctgcgcgcacggcgtgtgcggc
tcggatgcgatgcgcatcaacggggtcaaccggctggcgtgcaaggtgctgatgcgcgac
atgctgccgaagaacccgaagaagcagctcaccatcaccatcgagccgatccgcggcctg
cccgtggagaaggacctcgtggtcgacatggagccgttcttcgacgcctaccgcgcggtc
aagccgtacctgatgaccagcggtaaccagcccaccaaggaacgcatccagagccaggtc
gaccgggcccggtacgacgacaccaccaagtgcatcctgtgcgcggcgtgcaccaccagc
tgcccgatctactggaccgagggcagctatgtgggcccggcggcgatcgtcaacgcccac
cggttcatcttcgacagccgcgacgagggtgcggccgagcgtctcgacatcctcaacgac
gccgacggtgtgtggcgctgccgcacgacgttcaactgcaccgaggcctgcccgcgcggc
atccagatcacccaggcgatccaggaggtcaagcgcgcactgatgttcgcgcgctga

DBGET integrated database retrieval system