KEGG   Mycobacterium sp. JLS: Mjls_1254Help
Entry
Mjls_1254         CDS       T00482                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00020  Citrate cycle (TCA cycle)
mjl00190  Oxidative phosphorylation
mjl00650  Butanoate metabolism
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01120  Microbial metabolism in diverse environments
mjl01130  Biosynthesis of antibiotics
mjl01200  Carbon metabolism
Module
mjl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mjl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mjl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mjl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mjls_1254
   00650 Butanoate metabolism
    Mjls_1254
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mjls_1254
Enzymes [BR:mjl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Mjls_1254
    1.3.5.4  fumarate reductase (quinol)
     Mjls_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABN97056
LinkDB All DBs
Position
complement(1331718..1333472)
Genome map
AA seq 584 aa AA seqDB search
MLIEHRYDVVIVGAGGAGMRAAVEAGPRARTAVLTKLYPTRSHTGAAQGGMCAALANVEE
DNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRTPEGRIDQRRFGGH
TRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDITLTETPGGPVATG
VIAYELATGDIHVFHAKAIVFATGGSGRMYKTTSNAHTLTGDGLGIVFRKGLPLEDMEFH
QFHPTGLAGLGILISEAVRGEGGRLLNGDGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPNKDYVYIDVRHLGEDVLEAKLPDITEFARTYLGVDPVKELVPVYPTCHYVMGGI
PTTVHGQVLRDNTTIVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAANYAL
GHDFVDLPERPAEMVVNWVGDILSEHGNERVADIRGALQQSMDNNAAVFRTEETLKQALT
DIHALKERYSRITVQDKGKRYNSDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDY
PNRDDTNYMRHTMAYKEGTDLLSDVRLDYKPVVQTRYEPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgttgattgaacatcgctacgacgtcgtcatcgtcggggccggcggcgcgggtatgcgc
gccgcggtcgaggcaggtccgcgcgcccgcaccgcggtgctgaccaagctgtacccgacc
cgcagccacaccggcgccgcccagggcggcatgtgcgccgcgctggccaacgtcgaagag
gacaactgggagtggcacaccttcgacaccgtcaagggcggcgactacctcgccgaccag
gacgccgtcgagatcatgtgcaaggaagccatcgacgcggtgctcgacctcgagaagatg
gggatgcctttcaaccgcacccctgagggccgcatcgaccagcgccggttcggcgggcac
acccgtgaccacggaaaggccccggtgcgccgggcgtgttacgccgccgaccgcaccggc
cacatgatcctgcagacgctgtaccaaaactgcgtcaaacacgacgtcgagttcttcaac
gagttctacgccctcgacatcacgctgaccgagacccccggcggcccggtggccaccggc
gtgatcgcctacgagttggcgaccggcgacatccacgtcttccacgccaaggcgatcgtg
ttcgccaccggcggttcgggccggatgtacaagacgacgtccaacgcgcacacgctgacc
ggtgacgggctgggcatcgtcttccgcaagggtctgccgctggaggacatggagttccac
cagttccacccgacgggtctggccggcctcggcatcctcatctccgaggccgtgcgcggt
gagggcggtcgcctgctcaacggcgacggcgagcggttcatggagcgctacgcgccgacc
atcgtcgacctcgccccgcgtgacatcgtcgcccgctcgatggtcctcgaggtgctcgag
ggccgcggcgccgggccgaacaaggactacgtctacatcgacgtgcgccacctcggcgag
gacgtcctcgaggcgaagctgcccgacatcaccgagttcgcccgcacctacctcggtgtc
gacccggtcaaggaactggtaccggtctacccgacatgccactacgtcatgggcggcatc
ccgaccaccgtgcacggtcaggtgctgcgcgacaacaccacgatcgtgccgggtctctac
gccgccggcgagtgcgcctgcgtgtcggtgcacggcgccaaccggctgggcaccaactcg
ctgctcgacatcaacgtgttcggccgccgcgccgggatcgccgccgccaactacgcgctc
ggccacgacttcgtcgacctgcccgagcggcccgccgagatggtggtcaactgggtcggc
gacatcctctccgagcacggcaacgagcgcgtcgccgacatccgcggggcgctgcagcag
tcgatggacaacaacgccgcggtgttccgcaccgaggagaccctcaagcaggccctgacc
gacatccacgcgctcaaggagcgctactcgcgaatcacggtgcaggacaagggcaaacgc
tacaacagcgacctgctcgaggcgatcgaactcggcttccttctcgaactggccgaggtc
accgtcgtcggtgcactcaaccgcaaggagtcccgcggcggccacgcgcgcgaggactac
ccgaaccgcgacgacaccaactacatgcgccacaccatggcctacaaggagggcaccgac
ctgctctccgacgtgcgcctggactacaagcccgtggtgcagacccgctacgagccgatg
gagcggaagtactga

DBGET integrated database retrieval system